KEGG   Myotis brandtii (Brandt's bat): 102259616Help
Entry
102259616         CDS       T02920                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00030  Pentose phosphate pathway
myb00480  Glutathione metabolism
myb01100  Metabolic pathways
myb01200  Carbon metabolism
myb05230  Central carbon metabolism in cancer
Module
myb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
myb_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102259616
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102259616
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    102259616
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myb04147]
    102259616
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     102259616
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     102259616
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102259616
  Exosomal proteins of colorectal cancer cells
   102259616
  Exosomal proteins of bladder cancer cells
   102259616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 102259616
NCBI-ProteinID: XP_005874149
UniProt: S7N6K2
Position
Un
AA seq 515 aa AA seqDB search
MAEQVDLSRTQVCGILREELYRGDAFHQSETHIFIIMGASGDLAKKKIYPTIWWLLRDGL
LPENTFIVGYARSRLTVADIRQQSEPFFKATPEEKAKLEEFFARNSYVSGQYDQAASYEH
LNDHINALCQGSQANRLFYLALPPTVYEAVTKNIRETCMSQTGWNRIIVEKPFGKDLQSS
DRLSNHISSLFCEDQIYRIDHYLGKEMVQNLMVLRFANKIFGPIWNRDNVACVILTFKEP
FGIEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPASTDSDDVRNEKVKVLKCISEAQL
KNVVLGQYVGNPKGEGEATKGYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFILRCGK
ALNERKAEVRLQFRDVAGDIFQHQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESEL
DLTYGNRYKNVKLPDAYERLILDVFCGNQMHFVRSDELRQAWRVFTPLLHQIEHEKPQPI
PYVYGSRGPAEADELMKRVGFQYGGTYKWVTPHKL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcaggtggacctgagccggacccaggtgtgcgggatcctgcgggaagagctg
tatcggggtgatgccttccatcagtccgaaacgcatatcttcatcatcatgggggcatcg
ggtgacctggccaagaagaagatctaccccaccatctggtggctgctccgggatggcctt
ctgcccgaaaacaccttcatcgtgggctatgcccgctctcgcctcacggtggctgacatt
cgtcagcagagcgagcccttcttcaaagccacccccgaggagaaggccaagctggaggag
ttctttgcccgcaactcctacgtgtctggccagtacgatcaagcggcctcctatgagcac
ctcaatgaccacataaacgccctctgccaggggtcccaggccaaccgcctcttctacctg
gccttgccccccactgtctacgaggccgtcaccaagaacatcagagagacctgcatgagc
cagacgggctggaaccgcatcattgtagagaagcccttcgggaaggacctgcagagctcc
gaccgcctgtccaaccacatctcctccctgttctgtgaggaccagatctaccgcatcgac
cactacctgggcaaggagatggtccagaacctgatggtgctgaggtttgccaacaagatc
tttggccccatctggaaccgggacaatgtcgcctgcgtcatcctcaccttcaaggagccc
tttggtattgagggccgcgggggctacttcgatgaatttgggatcatccgggacgtgatg
cagaaccacctgctgcagatgctgtgtctggtggccatggagaagccggcctccacggac
tcggacgacgtccgcaatgagaaggtcaaggtgttgaaatgcatctcagaggcgcagttg
aaaaatgtggtgttgggccagtacgtgggcaatcccaagggggagggcgaggccaccaaa
gggtacctggacgaccccacggtaccccggggatccaccactgccaccttcgcagctgtt
gtcctctatgtggaaaacgagaggtgggatggggtgcccttcatcctgcgctgcggcaaa
gccctgaacgagcgcaaggccgaggtgcgcctgcagttccgcgacgtggccggcgacatc
ttccagcaccagtgcaagcgcaacgagctggtgatccgtgtgcagcccaacgaggccgtg
tacaccaagatgatgaccaagaagcccggcatgttcttcaaccccgaggagtccgagctg
gacctcacctacggcaacagatacaagaacgtgaagctccccgatgcctatgagcgcctc
atcctggacgtgttctgtgggaaccagatgcattttgtgcgcagcgacgagctccggcag
gcctggcgggtcttcacgccgctgctgcaccagatcgagcacgagaagccgcagcccatc
ccctacgtttacggcagccgaggtccagcggaagcagatgagctgatgaagagagtgggc
ttccagtatgggggcacttacaagtgggtgacaccccacaagctctga

DBGET integrated database retrieval system