KEGG   Myotis brandtii (Brandt's bat): 102260334
Entry
102260334         CDS       T02920                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:myb01002]
    102260334 (ERAP1)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102260334 (ERAP1)
Peptidases and inhibitors [BR:myb01002]
 Metallo peptidases
  Family M1
   102260334 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102260334
NCBI-ProteinID: XP_005871587
Position
Un
AA seq 944 aa
MKMISLSSKWSLRTMSFLPSSLLILLVVPTPSCCQSSETAPPRTSDGTLFPWNKMRLPEH
IVPVHYDLLIHANLTTLTFEGTTAINITASQPTSAIILHSQHLQILRATLKKGAGETQSE
EPLRVLEYPPREQIALLAPAPLEVGLPYTVVLGYAGNLSESFRGFYKSTYRTKEGEVRIL
ASTQFEPTAARMAFPCFDEPAFKATFSIKIRREPRHLAISNMPLVKSVTIAEGLIEDHFD
VTVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKITQADYALDAAVTLLEFYEDYF
SIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVSHELAH
QWFGNLVTMEWWNDLWLNEGFAKFMEFVSVRVTHPELKVEDYFLGKCFDAMEVDALNSSH
PVSTHVENPAQIREMFDEVSYDKGSCILNMLRDYLSADTFKRGIVHYLQTYSYKNTKNED
LWNSMASICPTDSSQRMEGFCSRGQHSSSSSHWQQEGLDVKTMMNTWTLQKGFPLITVTV
KGRNVHLKQEHYMKGSEGSPESGYLWHVPLTFITSKSESAQRFLLKTKTDVLILPEEVEW
IKFNVGMNGYYIVHYEDDGWDSLTGLLQGTHTAISSNDRASLINNAFQLVSIGKLPIEKA
LNLTLYLKHETEIMPVFQGLNELVPMYKLMEKRDMNEVEIQFKGFLIRLLRGLIDKQAWT
DEGSVSERMLRSQLLLLACVRKYQPCVQRAEGYFREWKETNGDLRLPNDVTMAVFAVGAQ
TTEGWDFLYRKYQSSLSSTEKNQIEFALCISQNKEKLQWLLEQSFKGDVIKTQEFPDILR
AIGRNPVGYPLAWQFLRENWNKLIQKFDLGSPSIAHMVMGTTNQFSTRARLEEVKEFFSS
LKENGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQNQNLELL
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgaagatgatatctctgtccagcaaatggtcgcttagaaccatgtcatttctaccttcc
tcactgttgattctcttagttgtgccaactccttcctgctgtcagagcagtgaaactgca
cctccaagaactagtgatgggaccctgttcccttggaataagatgagacttcctgagcac
atcgtcccagttcattatgatctcctgatccatgccaacctcaccactctgactttcgag
gggaccacggcaatcaacatcacagccagccagcccaccagtgccatcatcctgcatagt
cagcacctgcagatattgagagccaccctcaagaagggagctggagagacgcagtccgaa
gaaccgctgcgagtcctggaatatccgcctcgcgagcagatcgcacttctggctcccgct
cctctggaggttgggctcccgtacacagtggtccttggttatgctggcaacctttctgag
agcttccgtggattttataaaagcacctacagaaccaaggaaggggaagtgaggattctt
gcatcaacacagtttgaacctactgcagccagaatggcctttccctgcttcgatgaacct
gccttcaaagcgactttttccatcaagatcagaagggagccaaggcacctcgccatctcc
aatatgccattggttaaatccgtgaccattgctgaaggactcatagaagaccattttgat
gtcaccgtcaagatgagcacctacctcgtggccttcattatttcagactttaagtctgtc
agcaagatgaccaagagcggagtcaaggtgtccgtgtatgccgtgccagacaagatcacc
caggcagactatgcactggatgctgcggtgactcttctggaattttatgaggattatttt
agcattccgtatcccttacccaaacaagatcttgctgccattcctgactttcagtctggt
gcgatggaaaactggggactgaccacatatcgggaatctgctctcttgtttgatgcggaa
aagtcttctgcatcaagtaagcttggcatcacgatgactgtgtcccatgagctcgcccac
cagtggtttgggaacctggtcactatggaatggtggaatgatctttggctcaatgaggga
tttgccaagtttatggagtttgtgtctgtccgtgtgactcatccagaactgaaagttgaa
gattatttccttggcaagtgttttgatgcaatggaggtagacgcattgaattcttcacac
cctgtgtccacacatgtggagaatcctgctcagattcgggagatgtttgatgaggtttct
tatgataagggatcttgtattctgaatatgctaagagattatcttagtgccgatacattt
aaacgtggtattgtacattatctccagacatatagttataaaaacacaaagaacgaggac
ctgtggaacagtatggcaagtatttgccctacagacagctcacaaaggatggagggcttt
tgctctcggggtcaacattcatcttcatcctcacactggcaacaggaaggccttgatgtg
aaaaccatgatgaacacctggacgctgcagaagggcttccccctgataaccgtcacagtg
aaagggaggaacgtccacctgaagcaagagcactatatgaaaggctctgaaggcagccca
gaatctgggtacctgtggcatgttccactgacattcatcaccagcaaatcagaatcggcc
cagagatttttgctgaagacaaaaacagatgtgctcatcctcccagaagaggtggaatgg
atcaaatttaacgtgggaatgaatggctattacattgtgcattatgaggatgatggatgg
gattctttgactggccttttacaaggaacgcacacagcaatcagcagtaatgatcgggcc
agtctcattaacaatgcatttcagcttgtcagcattggaaagctaccgattgaaaaagcc
ttgaatttaaccctgtacttgaaacatgaaacagaaattatgcctgtgttccaaggtttg
aatgagttggtacctatgtataagttaatggagaaaagagatatgaatgaagtggaaatt
caattcaagggctttctcatcaggctgctgaggggcctcattgacaagcaggcatggact
gacgagggctctgtctcagagcgaatgctgcggagccagctcctcctcctcgcctgtgtg
cgcaagtatcagccctgcgtgcagagggcagaaggctacttcagagaatggaaggaaacc
aatggagatttgaggctgcccaatgatgtgacgatggcagtgtttgctgtgggagcccag
accactgagggatgggattttctctatcgtaaatatcagtcttctctgtccagtactgag
aaaaaccaaattgaatttgccctctgtattagccaaaacaaggaaaagcttcagtggtta
ctagagcaaagttttaagggagatgtaataaaaactcaagagtttccagatattcttaga
gctattggcagaaacccagtgggatatccactggcctggcagtttctgagggaaaactgg
aataaacttatacaaaagtttgaccttggctcaccttccatagcccacatggtgatggga
acaacaaatcagttctccacaagggcacggcttgaagaggtaaaagaattcttcagctct
ttgaaagaaaatggttctcagctccgttgtgtccaacagacaattgaaaccattgaggaa
aacatacgttggatggataagaactttgataaaatcagagtgtggctccaaaaccaaaat
cttgaactgctttaa

DBGET integrated database retrieval system