KEGG   Myotis brandtii (Brandt's bat): 102261193
Entry
102261193         CDS       T02920                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myb03036]
    102261193 (ANKRD53)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102261193 (ANKRD53)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 102261193
NCBI-ProteinID: XP_014396408
Position
Un
AA seq 482 aa
MAFQSAACAFDAEFPGRCCSVGGGWARRSAQPPSTPRASIEQVKKDSWVPRSSSIFRKPS
LVQGRLESNNCEWFAAALGHLEWLRFCLNPDLEGILTDNKGFTAIHFAAQKGKLECLQVL
VEEYQFPVDLPTKNGQTPLHLVIHKENKNTVLPCVHYLLQHGAALNTQTRNGSTPLHLAA
REGLLSCVKLLVENGANVHARDAIGCKPIDYCKIWNHRVCARFLKDAMWKRDKKDFACEM
GKLKGLKGQLALMERYYQTECQEEQELLRQADFKKWLHHKPLPRGRSLIHSIEQEPQAPP
WAIPISKTPKLSKHFHPSPEEHLQQTPQRKLQPSVTSIPHYMHPTVRQPKPWNISNNPAR
SPTAQIGSPQGIRLGVHPDPSLEHDFRGFLKIRSDGQGGAHLRTVTGKEVAPVPRLPLEV
IVRELYPHVRPCRMKVPQGFHSVSIKDVDRKRYLGDNTFWTDTLAMNLRETFDEAFLATV
QA
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggcctttcagtctgcggcgtgtgcgtttgatgccgagtttccaggacggtgctgctca
gtgggcgggggctgggcgaggaggagcgcacagcccccgtccacaccacgtgcctccata
gagcaggtgaagaaggactcctgggtccccaggagtagctctatcttcagaaagcctagc
ctggtccaggggcggttggagagcaacaattgcgagtggttcgcagccgccttgggccac
ctggaatggttgcggttctgtctgaatccggaccttgagggaatcctcaccgataacaag
ggtttcactgccatccactttgcagcccaaaaaggcaagctcgaatgcctgcaggtcttg
gtggaggagtaccagtttcccgtggacctgcccaccaaaaatggccagacgcccctgcac
ctcgtcatccacaaggagaacaagaacacggtcctcccctgcgttcactatctgcttcag
cacggggcagccctcaacactcagacacgcaatggctccacaccgctgcacctggcagcc
cgggagggcctgctgagctgtgtcaagctcctggtggagaatggcgccaatgtccatgcc
cgagatgccataggctgcaagcccatcgactattgcaaaatatggaaccaccgcgtctgt
gctcggttcttgaaggatgccatgtggaaacgggacaagaaggactttgcctgtgagatg
gggaagctgaaggggctcaaaggccagctggccctcatggagcggtactaccagactgag
tgccaggaagaacaagaacttctgagacaagctgatttcaagaagtggctccatcacaag
ccactgcctcgaggccggtctctgatccacagcattgagcaagagccccaagcccctccc
tgggccatccccatctccaagacccccaagctgtccaagcacttccacccctccccagaa
gagcacctgcaacagacaccacagcgcaagctgcagccctcggtgacatccataccccac
tacatgcatcccacagttaggcagcccaagccgtggaatattagcaacaaccctgccaga
tcccccaccgcccagatcggctccccacagggcatccgcctgggtgtgcatccagacccc
agcctggagcacgacttccgcggattcctcaagatcaggtctgatgggcaaggtggtgcg
cacttgcgcactgtgactggcaaggaggtggcccctgtgcctcggctgcctttggaggtg
atagtccgtgagctgtaccctcatgtgcggccgtgcaggatgaaggtgccccagggcttc
cactctgtcagcataaaggacgtggaccggaagcggtacttgggcgacaacaccttctgg
accgacactctggccatgaacttacgtgaaacatttgacgaagccttcctggcaacagtg
caagcc

DBGET integrated database retrieval system