KEGG   Myotis brandtii (Brandt's bat): 102261657
Entry
102261657         CDS       T02920                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00100  Steroid biosynthesis
myb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102261657 (TM7SF2)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102261657 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 102261657
NCBI-ProteinID: XP_005864516
Position
Un
AA seq 361 aa
MAPQGSRAPLEFGGPLGAAALMLLLPATMFHLLLSPGLTLCWGSGFQALVLTALLVGLGV
SAGLPLGMLTEMLLPLAWVATLTAFIFSLLLYLKALMAPASALAPGGNSGNPVYDFFLGR
ELNPRFGSFDCKYFCELRPGLIGWVLINLALLVQEAELRGSPSLAMWLVNGFQLLYVGDA
LWHEEAVLTTMDITHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLELPTASVICLVN
AVGYYIFRGANSQKNTFRKNPSDPSVAGLETISTATGRQLLVSGWWGMVRHPNYLGDLIM
ALAWSLPCGVSHLLPYFYLLYFTALLVHREARDEQQCLQKYGLAWREYCRRVPYRIVPYI
Y
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcccctcagggctcccgggccccgctggaattcgggggacccttgggcgctgcggcg
ctgatgctgctgctccccgccaccatgttccatctgctcctgtccccaggactcaccctg
tgctggggttcaggcttccaggccctggtgctgacagccctgctggtgggcctgggggtg
tcggccgggctgcccctgggaatgctcacggaaatgctcctgcccttggcgtgggtggcc
accctcaccgccttcatcttcagcctcctcctctatctgaaggcgctaatggcccctgcc
tccgccctggcacctggagggaactcaggcaatcccgtttacgactttttcttgggacgg
gagctcaacccgcgcttcggttcctttgactgcaaatacttctgcgaactgcggcctggc
ctcatcggctgggtcctcatcaacctggctctgctggtacaggaagcagaacttcggggg
agtccctccctggccatgtggctggtcaatggcttccagttactctatgtgggtgatgcc
ctctggcacgaggaagctgtactcaccaccatggacatcacacacgacgggtttggcttc
atgctggcctttggggacctagcctgggtacccttcacctacagcctgcaggcccagttc
ctgctgtaccacccacagcccctggagttacccacggcctcagtcatctgccttgtcaat
gctgttggttactacatcttccgtggagccaattcccagaaaaacaccttccgaaagaac
ccttccgaccccagtgtggccggccttgagaccatctctacagccacggggaggcagctg
ctagtgtctgggtggtggggtatggtccgccatcccaactatctgggagacctcattatg
gctctggcctggtccttgccctgtggggtgtcccacctgctgccttacttctacctcctc
tacttcactgcgctgctggtgcaccgtgaggcccgggacgagcagcagtgcctgcaaaag
tacggcctggcctggcgtgaatattgccgccgtgtgccctaccgaattgtgccttacatc
tactga

DBGET integrated database retrieval system