KEGG   Myotis brandtii (Brandt's bat): 102261934
Entry
102261934         CDS       T02920                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00230  Purine metabolism
myb00240  Pyrimidine metabolism
myb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102261934 (DCK)
   00240 Pyrimidine metabolism
    102261934 (DCK)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102261934 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_33 AAA_28 CoaE AAA_17
Other DBs
NCBI-GeneID: 102261934
NCBI-ProteinID: XP_005881688
Position
Un
AA seq 260 aa
MATPPKRSCPSPATSSEGTRIKKISIEGNIAAGKSTFVNILKQVCQDCEVVPEPIARWCN
VQSTQDEFQELTTSQKSGGNVLQMMYEKPERWSFTFQAYACLSRIRAQLASLNGKIKDAE
KPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
SPEKCLSRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPVLILDVNE
DFKDKHDSLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagaggagctgcccctctcccgcgaccagctcggagggaacccgc
atcaagaaaatttccatcgaagggaacatcgctgcagggaagtcaacatttgtgaatatc
cttaaacaagtctgccaggattgtgaagtggttcctgaacctattgccagatggtgcaat
gttcaaagtactcaagatgaatttcaggaactgactacatctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaaacctgagcgatggtcttttaccttccaggcatatgcc
tgcctcagtcgcatacgagctcagcttgcctctctcaacggcaagatcaaagatgcggag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgaatgtatgaatgaaacagagtggacaatttatcaggactggcatgac
tggatgaataaccaatttggccaaagccttgaactggatggaatcatttatcttcgagct
agtccagagaaatgcttgagtagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataagcatgaaagctggctcctgcacagaaca
ctgaaaaccaactttgattatctacaagaagtgcctgtcttaatattggatgttaatgaa
gactttaaagacaaacacgacagtctggttgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system