KEGG   Myotis brandtii (Brandt's bat): 102262387Help
Entry
102262387         CDS       T02920                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04060  Cytokine-cytokine receptor interaction
myb04080  Neuroactive ligand-receptor interaction
myb04152  AMPK signaling pathway
myb04630  Jak-STAT signaling pathway
myb04920  Adipocytokine signaling pathway
myb04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102262387 (LEPR)
   04152 AMPK signaling pathway
    102262387 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102262387 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    102262387 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102262387 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102262387 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:myb04050]
    102262387 (LEPR)
   04090 CD molecules [BR:myb04090]
    102262387 (LEPR)
Cytokine receptors [BR:myb04050]
 Interleukin receptor families
  Prolactin receptor family
   102262387 (LEPR)
CD molecules [BR:myb04090]
 Proteins
  102262387 (LEPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3 Interfer-bind
Motif
Other DBs
NCBI-GeneID: 102262387
NCBI-ProteinID: XP_005868091
Position
Un
AA seq 1164 aa AA seqDB search
MTCQKFCMALLQWEFIYVITAFNLAYPSTPWRFKLFCMPPNTTYDFLLPAGIPKNTSNLN
GYYEPLLEAKFNSSGTYYSNLTSKTTFHCCIWSEENENCSVQADNIEGKAFVSTVNSLVF
QQIGANWNIQCWMKEDLELFICYIEPLFNNSFKNYDLKVHLLYVLPEVLAESPLVPQKGS
FQLVQCNCSAHKCCECHVSVPAAKLNCTLSMYLKITSGGVVFQSPLMSVQPITIVKPDPP
LGLHMEITDSGDLKISWSSSTLVPFQLQYEVKYSENSTSMREADEIVSATSLLIDSVLPG
SSYEVQVRGKRLDGPGIWSDWSNPLIFTTQDVIYFPPKILTSVGSNVSFHCIYKNENKIV
SSKNIVWWMNLAEKIPESQYNIVGDHVSKVTLPSLNATRLRGKFTYDAVYCCNEHECHHR
YAELYVVDVNINILCETDGYLTKMTCRWSTNAIQSLSGSTLQLRYHRSSLYCSDVPSIHT
TSEPKDCHLRRDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVVPDSMVKPLPPS
SVKAEITAKIGLLKISWKKPIFPENNLQFQIRYGLNGKEIQWKMYEVYDAKSKSVSLPVP
DLCAVYAAQVRCKRLDGLGYWSNWSTPAYTVVMDVKVPIKGPEFWRIIHEDSTKKERNVT
LLWKPLMKNDSLCRVRRYVVKHRTARNGTWSEDVGNHTKFTFQWTEQTHTVTVLAVNSIG
ASFANFNLTLSWPMSKVNIVQSLNAYPLNSSCVILSWMLSLSDYNLIYFILEWKILNEDS
EIKWRRIPSSVKRYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQADAG
LYVIVPIIISSLTLLLGALLILHQRMKKLFWDDVPNPKNCSWAQGLNFQKPETFEHLFIK
HTESVTFGPLLLEPETISEDISVDTSWKNKDEKVQTALVPLLLTTADLEKGSICINDQRN
SASFSEAGSTKITCEDEGRRQPSVKYATLLCNSKSSAIDDEQGLTNSSVSKCFSSKNSPS
KDSLSNSSWEIETQAFFMLSDQHPNIISPHLTFSEELDKLLTLEGNFSEENNDEKSVYYL
GVTSMKKESSVFPTDESGVLCPFPAHCLFTDIRILQDSCSHLVENNFNLGTSGQKTFVSY
MPQFQTCSIQTQKIMENKMCDLTV
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgacttgtcaaaaattttgtatggctttgttacagtgggaatttatttatgtgataacg
gcatttaacttggcatatcccagtactccttggagatttaagctgttttgcatgccacca
aacacaacttacgactttctcttgcctgctggaatcccaaagaacacttcaaatttgaat
ggatattatgagccacttttagaagctaaatttaattcaagtggtacctactattctaac
ttaacatccaaaacaactttccactgttgcatttggagtgaggaaaatgaaaactgctct
gtacaagcagacaacattgaagggaaggcattcgtttcaacagtaaattctttagttttt
caacaaataggtgcaaactggaacatacagtgctggatgaaagaggacttggaattattc
atctgttatatagagccattatttaacaattctttcaagaattatgaccttaaggtccat
cttttatatgttctgcctgaagtgttagcagaatcaccgttggtcccccagaaaggcagt
ttccagcttgttcagtgcaactgcagtgctcataaatgttgtgaatgccatgtgtctgtg
ccagcagccaaactcaactgcactctctctatgtatttaaaaatcacatctgggggagtg
gtttttcagtcacctttaatgtcagttcaacccatcactatcgtgaagcccgatccacca
ttaggtttgcatatggaaatcacagacagtggtgatttaaagatttcttggtccagttca
acattggtaccatttcaacttcaatatgaagtgaaatattcagagaattctacaagtatg
agagaagctgatgagatcgtctcagccacatctctgctaatagacagtgtgcttcctggg
tcttcgtatgaggttcaggtgaggggcaagaggctggatggcccaggcatctggagtgac
tggagcaaccctcttatttttaccacacaagatgtcatatactttccacctaaaattctg
acaagtgttgggtctaatgtttcttttcactgcatctacaaaaatgaaaacaagatcgtt
tcctcaaaaaatattgtttggtggatgaatttagctgagaaaattcctgaaagccagtat
aacattgtgggcgaccatgttagcaaagttactcttcccagtttgaatgcaaccagactg
cgaggaaagttcacctacgatgcagtgtactgctgcaacgagcatgagtgccaccatcgc
tatgctgaattgtatgtggttgatgtcaatatcaatatattatgtgaaactgatgggtac
ttaactaaaatgacttgcagatggtcaactaatgcaatccaatcactctcggggagtact
ttgcaattgaggtatcataggagcagcctttattgttctgatgttccgtctattcacacc
acctctgaacccaaagattgccatttgcggagagatggtttttatgaatgcatatttcag
ccaatctttctcttatccggctacacaatgtggataaggatcaaccactctctgggttca
ttggattctcctccaacgtgtgttgttcctgattccatggtaaaaccattgcctccatcc
agtgtgaaagcagaaattactgcaaaaattggattattgaaaatatcttggaaaaagccc
atttttccagagaataatcttcagttccagattcgttatggcttaaatggaaaagaaata
cagtggaagatgtatgaggtatatgatgcaaaatcaaaatctgtcagtctcccggtgcca
gacctgtgtgcagtctacgccgctcaggtgcgctgtaagaggctggatggactgggatat
tggagtaattggagtactccagcctacacagtggtcatggatgtaaaagttcctatcaaa
ggacctgaattttggagaataattcatgaagacagtacaaaaaaggaacgaaatgtcact
ttactttggaaacccctgatgaaaaatgattcattgtgccgtgtgaggagatatgtagta
aagcatcgcactgcccgcaatggaacatggtcagaagatgtgggcaaccacaccaaattc
actttccaatggacagagcaaacacatactgttacagttctggctgtcaattcgattggt
gcctcttttgcaaattttaatttaacgctctcatggcccatgagcaaagtaaatatcgtg
cagtcactcaatgcttatcctttaaatagtagttgtgtgattctttcctggatgctatca
cttagtgattacaatctgatatattttattcttgagtggaaaattcttaatgaagacagt
gaaattaaatggcgtagaatcccttcgtctgttaagagatattatatccatgatcatttt
atcccaattgagaagtatcaattcagtctttaccctatatttatggaaggagtggggaaa
ccgaagataattaatagttttacccaagatgatattgaaaaacaccaggctgatgcaggt
ctatatgtaattgtgccaataattatttcttcattaaccttgttgcttggagcattgcta
atattacatcaaagaatgaagaagctgttttgggatgatgttccaaaccccaagaattgt
tcctgggcacaaggacttaattttcaaaagccagaaacgtttgagcatctttttatcaag
catacagaatcagtgacatttggtcctcttcttttggagcctgaaaccatttcagaagat
atcagtgttgatacatcgtggaaaaataaagatgagaaggtgcagactgctttggttcct
ctacttttgacaactgcagatcttgaaaagggttccatttgtattaatgaccaacgcaat
agtgctagcttctcggaggcagggagcaccaagataacctgtgaggatgaaggcaggaga
caaccctctgttaaatatgccaccctgctctgcaactctaagtcaagtgcaattgatgat
gagcaagggcttaccaatagctcagtcagcaaatgcttctctagcaaaaattctccatca
aaggattccttatctaatagctcctgggagatagaaacacaggcattttttatgttatca
gatcagcaccccaatataatttcaccacaccttacattctcagaagaattggataaactt
ttgacccttgaaggaaatttctctgaagaaaataatgatgaaaagtctgtctattattta
ggggtcacctcaatgaaaaaagagagtagtgtgtttccgacagatgagtcaggggtgttg
tgtccattccccgcccactgtttattcactgacatcagaatcctccaggacagttgctca
caccttgtcgaaaataatttcaacttaggaacttctggtcagaagacttttgtgtcttac
atgcctcaatttcagacttgttccattcagactcagaagataatggaaaacaaaatgtgt
gacctaactgtctaa

DBGET integrated database retrieval system