KEGG   Mycobacteroides abscessus 4529: NF90_05120Help
Entry
NF90_05120        CDS       T03535                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
myc  Mycobacteroides abscessus 4529
Pathway
myc00071  Fatty acid degradation
myc00072  Synthesis and degradation of ketone bodies
myc00280  Valine, leucine and isoleucine degradation
myc00310  Lysine degradation
myc00362  Benzoate degradation
myc00380  Tryptophan metabolism
myc00620  Pyruvate metabolism
myc00630  Glyoxylate and dicarboxylate metabolism
myc00640  Propanoate metabolism
myc00650  Butanoate metabolism
myc00900  Terpenoid backbone biosynthesis
myc01100  Metabolic pathways
myc01110  Biosynthesis of secondary metabolites
myc01120  Microbial metabolism in diverse environments
myc01130  Biosynthesis of antibiotics
myc01200  Carbon metabolism
myc01212  Fatty acid metabolism
myc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:myc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NF90_05120
   00630 Glyoxylate and dicarboxylate metabolism
    NF90_05120
   00640 Propanoate metabolism
    NF90_05120
   00650 Butanoate metabolism
    NF90_05120
  Lipid metabolism
   00071 Fatty acid degradation
    NF90_05120
   00072 Synthesis and degradation of ketone bodies
    NF90_05120
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NF90_05120
   00310 Lysine degradation
    NF90_05120
   00380 Tryptophan metabolism
    NF90_05120
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NF90_05120
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NF90_05120
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NF90_05120
Enzymes [BR:myc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NF90_05120
Exosome [BR:myc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NF90_05120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AIV19568
Position
1074776..1076278
Genome map
AA seq 500 aa AA seqDB search
MALDPRTPVLVGTGQVNQRTDADTPFSEIPEPIDLMEQAARLAAGDAGVAELLGAIDTIS
VANIFSWKYRDPGVLLGERLGAVPKRTFYTGPSGNSPQLLVNHAAADILAGDADVVLIGG
AEMWRSRNKMMATGVQPTWTIQDESVAEATVLGGRMDQVGGAETAIGLISPGHVYPLFEE
AIRIAGGASIADHRAAISQLWQRFNAVAVTNGHAWSNDAYTAEEIATPGPDNRWISSPYT
KLMNSNNMVEQGAVVLLTSVETARRLGISKDRWIFPLAGAQANDTFALSERHELHRSPAI
RLAGRRAFEIAGLGTDDVELVDIYSCFPSAVQVAAAELGLALDDPARPLTVTGGLTFAGG
PWCNYVTHSIATMAERLRERPGAKGLITANGGYLTKHAFGIYGTEPPASGFAYEDVQADV
DQEPRTEAADGYTGTAAVEAWTVNYGRDGSPFQTFVSVRTPTGARTFAKIDDRDASAHIA
DTDIAGASIEVAADGSARLN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccctagaccctcgcacgccggtcctcgtcggaaccggacaggtcaaccagcggaca
gacgcggacactccgttctcggagatccccgagcccatcgatctcatggagcaggcggcg
cgcctggcggccggcgacgcgggagtggccgagctgctcggcgcgatcgacacgatatcg
gtggcgaacatcttctcgtggaagtaccgcgaccccggagtgctgctcggtgagcgcctg
ggcgcggtgcccaagcgcaccttttacacgggccccagcggcaactcgccgcagttgctg
gtcaaccacgccgccgccgacatcctggccggggatgctgacgtggtgctcatcggtggc
gcagagatgtggcgttcacgcaacaagatgatggccaccggagtacagcccacctggacc
atccaggatgaatcagtagccgaggcaacagttctcggtggccgcatggatcaagtcggt
ggcgccgaaaccgccattggcctcatctcgccgggtcacgtctacccgctcttcgaggag
gcgatacggattgccgggggtgcgtccatcgccgaccaccgcgcagcgatatcacaactg
tggcagcggttcaacgcggtagcggtcaccaatggccatgcctggtccaacgacgcgtac
accgccgaggagatcgccacccccggccccgacaatcgatggatcagttctccgtatacc
aagctgatgaactcgaacaatatggtcgagcagggcgcagtggtgttgttgacctccgtg
gagactgcgcggcggctaggaatctccaaggaccgctggatatttccgctcgccggtgcg
caggccaacgacaccttcgccctcagtgaacgccatgaattgcaccggtcgccggccatc
cggctggcgggcaggcgcgcattcgagattgccggactgggcaccgacgatgtcgaactg
gtcgacatctactcgtgctttccgtcggcggtgcaggttgccgccgctgaactggggctg
gcactcgatgacccggcgcggccgctgacagtcaccggtggtctcaccttcgccggcggg
ccctggtgcaactacgtcacccactccatcgccaccatggcggagcggctgcgcgagcgt
ccgggggcgaagggcctgatcaccgccaacggtggatatctcaccaagcacgccttcgga
atctacggaaccgagccgcccgcatccggattcgcatatgaggacgtacaggccgacgtc
gatcaagaaccccggaccgaggccgccgacggctataccggtacggcagccgtggaggca
tggaccgtcaactacggacgggacggatcgccgttccagacgttcgtcagtgtgcgcacg
ccgacaggagcgcgcacctttgccaagatcgatgaccgagacgcctccgcgcacatcgcg
gataccgatatcgccggcgcctcaatcgaagtggcggcggacggatccgcgcgcctcaac
tga

DBGET integrated database retrieval system