KEGG   Myotis davidii: 102752111Help
Entry
102752111         CDS       T02992                                 

Gene name
PAH
Definition
(RefSeq) phenylalanine hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
myd  Myotis davidii
Pathway
myd00360  Phenylalanine metabolism
myd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
myd00790  Folate biosynthesis
myd01100  Metabolic pathways
myd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    102752111 (PAH)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    102752111 (PAH)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102752111 (PAH)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     102752111 (PAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT EcoEI_R_C ACT_4
Motif
Other DBs
NCBI-GeneID: 102752111
NCBI-ProteinID: XP_006769417
Position
Un
AA seq 441 aa AA seqDB search
MSAVVLENRRGLTRKLSDFGQETSYIENNSNENDAISLIFSLKEEVGALAKVLRLFEENE
INLTHIESRPSRLKKDEYEIFTSLDKSSMPTLANIIRILKHEIGATVHELSREKKKDTVP
WFPRTIQDLDRFANQILSYGAELDADHPGFKDPVYRARRKYFADIAYNYRHGQPIPRVEY
TEEEKKTWGTVFKTLKSLYKTHACYEHNHIFPLLEKYCGFREDNIPQLEEVSQFLQSCTG
FRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSF
AQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLS
DKPMLLPLELEKTAIQEYTITEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQ
RIEVLDNTQQLQILADSINSK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgtggtcctggagaaccgaagaggcctgaccaggaaactctcagactttggc
caggaaacaagctatattgaaaacaactccaatgaaaatgatgccatatcactgattttc
tcactcaaagaagaagttggcgcactggccaaagtcttgcgcttatttgaggagaatgaa
ataaatctgacccacattgaatccagaccttcgcgcttaaagaaagacgagtatgaaatc
ttcaccagtctggacaagagcagcatgcctactctggccaacattattaggatcttgaag
catgaaattggtgctactgtgcacgagctttcccgagagaagaagaaagacacagtgccc
tggttccccaggacgattcaagatctggacagatttgccaaccagatcctcagctatgga
gcggaactggatgcagaccaccccggctttaaagatcctgtgtaccgagcaagacggaag
tattttgctgacatagcctacaactaccgacatgggcaacccattcctcgagtggaatac
acggaggaggaaaagaaaacctggggcacggtgttcaagaccctgaagtccttgtataaa
acccacgcttgctatgagcacaaccacatcttcccacttctggaaaagtattgtggcttc
cgtgaagataacattccccagctggaggaggtgtctcagtttctgcagagttgcactggc
ttccgcctccgacctgtggctggcctgctttcctctcgggatttcctgggtggcctggcc
ttccgagtcttccactgcacccagtacatcagacatgggtccaagcccatgtatacacct
gaacctgacatctgccatgagctgttgggacatgtgcccttgttttcagatcgaagtttt
gcccagttttcccaggaaattggccttgcctctttgggtgcacctgatgagtacatcgag
aaacttgccacgatttactggtttactgtggagtttgggctctgcaaacaaggggactcc
ataaaggcatatggcgctgggctcctgtcatcctttggtgaattacagtactgtttgtcg
gacaagcccatgctcctcccgctggagctggagaagacagccatccaggagtacacgatc
acagagttccagcccctgtattacgtggctgagagttttaatgatgccaaagagaaagta
aggaacttcgctgctacaatcccacggcccttctcagttcgttatgacccatacacccaa
aggattgaggtcttggacaatacccagcagcttcagattttggctgactccatcaacagt
aagtaa

DBGET integrated database retrieval system