KEGG   Myotis davidii: 102752290Help
Entry
102752290         CDS       T02992                                 

Gene name
PLK3
Definition
(RefSeq) polo like kinase 3
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
myd  Myotis davidii
Pathway
myd04068  FoxO signaling pathway
myd04625  C-type lectin receptor signaling pathway
myd05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102752290 (PLK3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102752290 (PLK3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102752290 (PLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myd01001]
    102752290 (PLK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myd03036]
    102752290 (PLK3)
   03400 DNA repair and recombination proteins [BR:myd03400]
    102752290 (PLK3)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     102752290 (PLK3)
Protein kinases [BR:myd01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   102752290 (PLK3)
Chromosome and associated proteins [BR:myd03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Polo kinases
    102752290 (PLK3)
DNA repair and recombination proteins [BR:myd03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102752290 (PLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 102752290
NCBI-ProteinID: XP_006769342
UniProt: L5LIB9
Position
Un
AA seq 585 aa AA seqDB search
MPDARSLQGGFARCYEVTDTETGSAYAVKVISQSRITKPHQREKILNEIALHRGLQHRHI
VRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGIL
HRDLKLGNFFITENMELKMGDFGLATRLEPPEHRKKTICGTPNYVAPEVLQRQGHGPEAD
VWSLGCVMYTLLCGSPPFETVDLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPQDR
PSIDQILRHDFFTKGYTPDRLPINSCVTVPDLVPLSPARILFVKVTKSLFGRKKNKSKNR
PEERDEVSCLVSGLTRTSIAHQDAKPEAPAASGPAPLSLVETAPEDSSPRGTLASSGDGF
EEGLTVATVVESALCALRNCLAFMPPADQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQLS
SRRVAVLFNNGTHMALSANRKTVHYNPTSTKHVSFPVGAVPRGLQPQLGVLRYFTSYMEQ
HLMKGGDLPSVEEVEVPVPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPL
LVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYTLRLLRDRCSA
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgcccgctccttacaggggggcttcgcccgctgctacgaggtcacggacaca
gagaccggcagcgcctacgcggtcaaagtcatctcgcagagccgcattaccaagccgcat
cagcgcgagaagatcctaaatgagattgcgctgcaccgcggcctgcagcaccgccacatc
gtgcgtttctcgcatcacttcgaggatgctgacaacatatacattttcttggagctctgc
agccggaagtccctggcccacatctggaaggcccggcacaccctgttggagccagaagtg
cgctactacctgcggcagatcctttcgggactcaagtacttgcaccagcgaggcatcttg
caccgagacctcaagctgggaaatttttttattactgagaacatggaactgaagatgggg
gattttgggctggccacccggttggagcccccagagcataggaagaagaccatctgtggc
acccctaactacgtggctccggaagtgctgcagagacagggtcacggcccagaggcagat
gtgtggtccctgggctgtgtcatgtacacactgctatgtgggagccccccctttgagaca
gtcgacctgaaggagacgtaccgctgcatcaaacaggttcactacacgctgcccgccagc
ctctcactgcctgcccggcagctcctggctgccatccttcgagcctcgccccaggaccgc
ccctcaattgaccagatcctgcgccatgacttctttaccaagggctacacccccgaccgg
ctccctatcaacagctgcgtgacagtcccagacctggtaccccttagcccagctaggatt
ctgtttgtcaaagttaccaagagcctctttggcaggaagaagaacaagagtaagaaccgt
cccgaggagcgggacgaggtttcctgtctggtgagcggcctcactcggacgtccattgcc
catcaggatgccaagcctgaggctccagcagcttctggtccagcccccctcagcctggta
gagacagcgcccgaagacagctcaccccgtgggacactggcgagtagtggagatgggttt
gaagaaggtctgaccgtggccacagtggtggagtcagcgctctgtgctctgaggaactgc
ctggccttcatgcccccagcggatcagaacccggctcccctggcccagccagagcccctg
gtgtgggtcagcaagtgggttgactactcaaacaagtttggctttgggtatcagctgtcc
agccgccgagtggccgtgctcttcaacaatggcacacacatggcgctgtcggccaacaga
aagactgtgcactacaaccccaccagcacaaagcacgtctccttccctgtgggtgctgtg
cctcggggcctgcagcctcagttgggtgtcttgcgatatttcacctcctacatggaacag
cacctcatgaagggtggagatctgcctagtgtggaagaagtggaggtgcctgtcccccca
ctcctgctgcagtgggtcaagactgatcaggccttactcatgctgtttagtgatggcacg
gtccaggtgaacttctacggagaccacaccaagctgatcctcagtggctgggagcccctc
cttgtgactttcgtggcccgcaaccgcagcgcttgtacttaccttgcttcccaccttcgg
cagctgggctgctccccggatctgcggcagcggctccgctatactctgcggctgctccgg
gaccgctgctcggcctag

DBGET integrated database retrieval system