KEGG   Myotis davidii: 102752637
Entry
102752637         CDS       T02992                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
myd  Myotis davidii
Pathway
myd00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102752637 (RDH5)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102752637 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 102752637
NCBI-ProteinID: XP_015412949
Position
Un
AA seq 344 aa
MWLPVLLGVLLWAALWLLRDRQSLPPSNAFVFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRAASSRLHTTLLDVTDPQSTQRAAKWVETYVGETGLFGLVNNAGVTGIIGP
TPWLTRDDFHRVLNVNTLGPIGVTLALLPLLQRARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTSVTNLESLENALQACWARLPPATQGHYGDA
FLTKSPGPRRGPEMGCSGTGTLIATTHWAADLEVQQHVMNLICDPDLTKVSRCLEHALTA
CHPRTRYSPGWDAKLLWLPASYLPASLVDAVLTWVLPKPAQAVS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtggctgcctgtgctgctgggagtcttactctgggcagccctgtggctgctcagagac
cggcagagcttgccccccagcaatgccttcgtcttcatcaccggctgtgactctggcttc
gggcggctcctggcactgaggctggaccagagaggcttccgagtcctggccagctgcctg
accccctcgggggcagaggacctgcagcgggctgcctcctcccgcctccacaccaccctg
ctggacgtcaccgacccccagagcacccagcgggcagccaaatgggtggaaacatatgtt
ggggaaacagggcttttcggtctggtgaataatgccggtgtaactggtatcattgggccc
acaccatggctgaccagggatgacttccaccgggtgctgaatgtgaacacactgggtccc
atcggggtcacccttgccctgctacctttactgcaacgggcccggggccgggtgatcaac
atcaccagcgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaagttt
ggcctggaggccttctcagacagtctgaggcgggatgtggctccttttggagtacgagtc
tccatcgtggagcctggctttttccgaacctctgtgacaaacctggagagtttggagaac
gccctgcaggcctgctgggcacggctgcctccagccacacagggacactatggggatgcc
ttcctgaccaagtccccaggacccagaagagggcctgagatgggctgcagtgggacaggg
acactgattgcaaccacccactgggctgcagacctggaagtgcagcagcatgtcatgaac
ctcatctgtgacccggacctgaccaaggtgagcaggtgcctggagcatgccttgactgct
tgccaccccaggacccgctacagcccaggctgggacgccaagctgctctggctgccagcc
tcctacctgccagccagcctggtggatgctgtgctcacctgggtccttcccaagcctgcc
caggcagtttcctga

DBGET integrated database retrieval system