KEGG   Myotis davidii: 102752711Help
Entry
102752711         CDS       T02992                                 

Gene name
DARS
Definition
(RefSeq) aspartyl-tRNA synthetase
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
myd  Myotis davidii
Pathway
myd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102752711 (DARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:myd01007]
    102752711 (DARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:myd03016]
    102752711 (DARS)
Enzymes [BR:myd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     102752711 (DARS)
Amino acid related enzymes [BR:myd01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   102752711 (DARS)
Transfer RNA biogenesis [BR:myd03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102752711 (DARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d S-AdoMet_synt_N
Motif
Other DBs
NCBI-GeneID: 102752711
NCBI-ProteinID: XP_006773157
Position
Un
AA seq 501 aa AA seqDB search
MPSASASRKTQEKPREVMDAAEDYAKERYGVSSMIQSQEKSDRVLVRVSNLTVQKADEVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANISKESIVDVEGVV
RKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAIRPEVEGEEEGRATVNQDTRL
DNRVIDLRTSTSQAVFRLQSGICHLFRETLTNKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVMEEIADTLVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGI
EMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNSKQSNSYDMFM
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF
LGLHNIRQTSMFPRDPKRLTP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgccagcgccagccgcaagactcaggagaagccgcgggaggtcatggacgcg
gcggaagattatgctaaagaaagatatggagtatcttcaatgatacagtctcaagaaaaa
tcagatcgagttttggttcgggttagcaatttgactgtacaaaaagctgatgaagttgtt
tgggtgcgtgcaagggttcatacaagccgagctaaagggaagcagtgtttcttagtccta
cgtcagcagcagtttaacgttcaggctcttgtggcagtgggagaccatgcaagcaagcag
atggttaaatttgctgccaacatcagcaaagagagcatcgtagatgtagaaggtgttgtg
agaaaagtgaatcagaaaattggaagctgtacacagcaagatgtagagctacatgttcaa
aagatttatgtgatcagtttggctgaaccccgtttgcccctgcagctggatgatgccatt
cggcctgaggtggaaggagaagaggaaggaagagctactgttaaccaggatacaagatta
gataacagagtcattgatcttaggacatcaactagccaggcagtctttcgtctccaatct
ggcatctgccatcttttccgagaaactttaactaacaaaggttttgtggagattcagact
cctaaaattatctcagctgccagtgaaggaggagccaatgtatttactgtgtcatatttt
aaaaataatgcatatttggctcagtccccacagctgtacaagcagatgtgtatttgtgct
gattttgagaaggttttctgtattggaccagtattcagagctgaagactctaatacccac
agacatctaactgaattcgttggtttggacattgaaatggctttcaattaccattaccat
gaagttatggaagaaattgctgacactttagtacaaatattcaaaggacttcaagaaagg
tttcaaactgaaattcagacggtgaataaacaattcccatgtgagccattcaaatttttg
gagcccactttaagactagagtattgtgaagcattggctatgcttagggaagctggaatt
gaaatgggagacgaagaagatctgagtacgccgaatgaaaaactgttgggtcgtttggta
aaggaaaagtatgataccgatttttatattcttgataaatatccattggctgtaagacct
ttctataccatgcctgacccaagaaattctaaacagtccaactcttatgacatgttcatg
agaggagaagaaatactatcaggagctcaaagaatacatgatcctcagctgctaacagag
agagccttacatcatggaattgatttggagaaaattaaggcatacattgattccttccgc
tttggagcccctcctcatgctggtggaggcattgggttggaacgagtgactatgctgttt
ttgggattgcacaatattcgtcagacctcaatgttcccccgtgatcccaaacgactcact
ccttaa

DBGET integrated database retrieval system