KEGG   Myotis davidii: 102752805Help
Entry
102752805         CDS       T02992                                 

Gene name
ACOX1
Definition
(RefSeq) acyl-CoA oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
myd  Myotis davidii
Pathway
myd00071  Fatty acid degradation
myd00410  beta-Alanine metabolism
myd00592  alpha-Linolenic acid metabolism
myd00640  Propanoate metabolism
myd01040  Biosynthesis of unsaturated fatty acids
myd01100  Metabolic pathways
myd01200  Carbon metabolism
myd01212  Fatty acid metabolism
myd03320  PPAR signaling pathway
myd04024  cAMP signaling pathway
myd04146  Peroxisome
Module
myd_M00087  beta-Oxidation
myd_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102752805 (ACOX1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102752805 (ACOX1)
   00592 alpha-Linolenic acid metabolism
    102752805 (ACOX1)
   01040 Biosynthesis of unsaturated fatty acids
    102752805 (ACOX1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102752805 (ACOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102752805 (ACOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102752805 (ACOX1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102752805 (ACOX1)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     102752805 (ACOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 102752805
NCBI-ProteinID: XP_006756428
Position
Un
AA seq 665 aa AA seqDB search
MAVTMNEDLRRERASASFNRELLTHILDGSPENTRRRREIENLILNDPDFKHEDLNFLTR
SQRYEVAVRKSATLVKKIREFGISDPDEIMWFKKLHMINFVEPVGLNFSMFIPTLLNQGT
SAQKEKWLLPAQGLQIIGTYAQTELGHGTHLRGLETTATYDPETQEFVLNSPTVTSIKWW
PGGLGKTSNHAIVLAQLYTQGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEMD
NGYLKMDHYRIPRENMLMKYAQVKPDGTYVKPVSNKLTYGTMVFIRSFLVGEAARSLAKA
CTIAIRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFHFVGAYMKETYHRIN
EDIGQGDLSELPELHALTAGLKAFTSWTTNAAIEACRMACGGHGYSHCSGLPNIYVTFTP
TCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTVVD
INSPHSLTEAYRLRAARLVEIAAKNLQTEVSHRKSKEVAWNLTSVDLVRASEAHCHYVTV
KLFSEQLLKVQDKPTQAVLRNLCLLYSLYGISQKAGDFLQENILTDSQITQVHQRIKELL
TVIRPDAVTLVDAFDFQDVSLGSVLGRYDGNVYENLFEWAKNSPLNKDEVHESFYKHLKP
LQSKL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaccatgaatgaggacctgcgccgggagcgggcctccgccagcttcaaccgc
gagctgctcacgcacattctggacggcagcccggagaacacccggcgacgccgagagatc
gagaacctgattctgaacgacccagacttcaagcacgaggacctgaacttcctcactcgc
agccagcgctacgaggtggctgtcaggaagagcgccaccctcgtgaagaagatcagggag
ttcggcatctcggacccggatgaaatcatgtggtttaaaaaactacatatgatcaatttt
gtggaacccgtgggcctcaatttctccatgtttattcccaccttgctgaatcagggcacc
agtgctcagaaagagaaatggctgcttcccgcccaaggactgcagataattggcacctac
gcccagacggagctgggccacgggactcatctgcgaggcttggaaaccacagccacatat
gaccctgaaacccaggagtttgttctcaatagtcctactgtgacctccatcaagtggtgg
ccgggtggacttggaaagacttcaaatcatgcgatagtactagcccagctctacacccag
gggaaatgctatggattacatgccttcattgtgcctattcgggaaattggaacccacaag
cctttgccagggatcaccgttggcgacattggccccaaattcggctacgatgagatggat
aatggctacctgaagatggaccattatcgtatccccagggaaaacatgctgatgaagtac
gcccaggtgaagcctgacggcacctatgtgaaacccgtgagtaacaagctgacctacggg
accatggtgttcatcaggtccttcctcgtgggagaagctgctcggagcctggccaaggcc
tgcaccattgccatccggtacagcgccgtgaggcaccagtcggaaatcaagccgggtgaa
ccagaaccacagattttggattttcaaacccagcaatataaactcttcccactgctggcc
acggcctatgccttccatttcgtaggcgcctacatgaaggagacctatcatcgcattaat
gaagacattggccagggggacctgagcgagctgcccgagcttcacgccctcaccgccggg
ctgaaggctttcacctcctggacgactaacgccgccatcgaagcctgtcggatggcctgt
ggcgggcacggctactctcactgcagcggcctcccaaacatctacgtcaccttcaccccg
acctgcaccttcgagggagagaacaccgtcatgatgctgcagaccgcccggtttctgatg
aaaagttacgaccaggtgcactcgggaaagctggtgtgtggcatggtgtcctacttgaat
gacctgcccagccagcgcatccagccgcagcaggtggccgtgtggcccaccgtggtggac
atcaatagcccccacagcctcaccgaagcctaccggctccgggcggccagattagtagaa
atcgctgccaaaaaccttcagacggaagtgagtcacagaaaaagcaaggaggtcgcgtgg
aacctgacttccgtggacctcgtgcgagcgagtgaggcgcactgccactacgtgacggtg
aagctcttttcggagcagctcctcaaagttcaagataagcccacccaggccgtcttgagg
aacctgtgcctcttgtactctctgtacgggatcagtcagaaggcgggggattttcttcag
gagaacatcctgacagactctcagatcacccaggtgcaccagcgcatcaaggagctactg
accgtgatccgcccggacgccgttacgctggtcgatgcgtttgatttccaggatgtgtcg
ctgggctccgtgctgggccgctacgatggcaacgtgtatgagaacctgttcgagtgggcc
aagaactcgccgctcaacaaagacgaggtccatgaatctttctacaagcacctgaagcca
ctgcagtccaagctctga

DBGET integrated database retrieval system