KEGG   Myotis davidii: 102754272Help
Entry
102754272         CDS       T02992                                 

Gene name
ST3GAL6
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 6
  KO
K03792  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 10) [EC:2.4.99.6]
Organism
myd  Myotis davidii
Pathway
myd00601  Glycosphingolipid biosynthesis - lacto and neolacto series
myd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    102754272 (ST3GAL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:myd01003]
    102754272 (ST3GAL6)
Enzymes [BR:myd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     102754272 (ST3GAL6)
Glycosyltransferases [BR:myd01003]
 Terminal extension
  Sialyltransferase
   102754272 (ST3GAL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 102754272
NCBI-ProteinID: XP_006769344
Position
Un
AA seq 331 aa AA seqDB search
MRGYLVAIFLSAVFLYYVLHCILWGTNVYWMPPVEMKRRNKVQLCSSKPAFASLLRFHQF
HPFLCAADFKKLASLYGSDKFDLPYGIRTSAEYFRLALSKLQSCDLFDESDNMPCKRCVV
VGNGGVLKNKTLGERIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPKHNDP
NTTAILTAFKPHDLKWLWELLTGGKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYE
LLNFPKVFPKNQKPKHPTTGIIAITLAFHICHEVHLAGFRYNFSDLQSPLHYYGNATMSL
MNKNAYHNVTAEQLFLKDIIEKNFVINLTQD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagaggctacctcgtggctatcttcctgagtgctgtcttcctctattacgtgctgcat
tgtatattatggggaacaaatgtctattggatgccacctgtggaaatgaaacgaagaaat
aaggtccagctgtgttcatcaaagccagcatttgcctctctcctgaggtttcaccagttt
cacccttttctttgtgcagctgattttaaaaagcttgcttccttgtatggtagcgataag
tttgatttgccctatgggataaggacctcagcggaatattttcgacttgctctttcaaag
ctgcagagctgtgacctctttgatgagtctgacaatatgccatgtaaaaggtgcgtggtg
gttggtaacggaggagttttgaagaacaagacgttaggagaaagaattgactcctatgat
gtaataataagaatgaataatggtcctgttttaggacacgaagaggaagttgggagaaga
acaaccttccgacttttttatccagaatctgttttttcagatcccaaacacaatgatcct
aacaccacagcgattctcactgcttttaagcctcacgatttaaagtggctgtgggaattg
ttgacgggtggcaagataaacactaatggtttttggaaaaaaccagccttaaacctgatc
tataaaccatatcaaatcagaatcttagatcctttcattatcagaacagcagcctatgaa
ctgcttaatttcccaaaagtgtttcccaaaaatcagaaacccaaacacccgacgacagga
attattgccatcaccttggcctttcacatatgtcatgaagtccaccttgctggctttaga
tacaacttttctgacctccagagccctttgcactactatgggaatgccaccatgtccttg
atgaacaagaatgcgtatcacaacgtgactgcagagcagctctttttgaaggacattata
gaaaagaactttgtaatcaatttgactcaagattga

DBGET integrated database retrieval system