KEGG   Myotis davidii: 102754472
Entry
102754472         CDS       T02992                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
myd  Myotis davidii
Pathway
myd04080  Neuroactive ligand-receptor interaction
myd04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102754472 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102754472 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 102754472
NCBI-ProteinID: XP_006754714
Position
Un
AA seq 86 aa
MERLSPATGLWSAVPCLFEPAFLLTGFLLLAGPLPQPSAGKGLEEGNIHHLVQPRGSRNG
PGPWQGGRRKFRRQRPRLSHKGPMPF
NT seq 261 nt   +upstreamnt  +downstreamnt
atggaaagattgtcccctgccacaggcctgtggtctgcggtcccctgcttatttgaacca
gccttcctgctaacaggctttctccttcttgcagggcccctgccacagccttctgccggg
aaggggctggaggaaggcaatattcaccacctggtgcagcccagagggtccaggaatgga
ccagggccctggcagggaggtcggagaaaattccgccgccagcggccacgcctctctcat
aagggccccatgcctttctga

DBGET integrated database retrieval system