KEGG   Myotis davidii: 102754486
Entry
102754486         CDS       T02992                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myd03036]
    102754486 (ANKRD53)
Chromosome and associated proteins [BR:myd03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102754486 (ANKRD53)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 102754486
NCBI-ProteinID: XP_015426951
Position
Un
AA seq 432 aa
LIQERVESNNCEWFAAALGNLEWLRFCLNPDLEGFLTDNKGFTAIHFAAQKGKLECLQVL
VEEYKFPVDLPTKNGQTPLHLVIHKENKNVVLPCVHYLLQHGAALNTQTRNGSTPLHLAA
REGLLSCVKVLVKNGANVHARDAIGCKPIDYCKIWNHRVCARFLKDAMWKRDKKDFAYEM
GKLKGLKGRLALMQRYYLTEYQEEQQLLRQADFKKWLHHKPLPRGQSLIHSIEQEPPAPS
RAIPVSKTPKLSKHFHLFPQEHLQQTSQPKLQPSVSSTPHYRHPTVRQPKPWNISNNPAR
SPTAQIGSPQGIRLGVNPDPSLEHNLSGFLKIRSDGQGGTHLCTVTGKQVAPVPRLPLEV
IVRELYPHMRPCRMKVPQGFHSVSIQDVDRKRYLGDNTFWTDTLAMNLRETFDEAFLAAV
QAHQGLPILPCP
NT seq 1299 nt   +upstreamnt  +downstreamnt
ctgatccaggagagggtagagagcaacaattgcgagtggttcgcagccgccttgggcaac
ctggaatggttgcggttctgtctgaatccggaccttgagggattcctcacggataacaag
ggtttcactgccatccactttgcagcccaaaaaggcaagctcgagtgcctgcaggtcttg
gtggaggagtacaagtttcccgtggacctgcccaccaagaatggccagacaccgctgcac
ctcgtcatccacaaggagaacaagaacgtggtcctcccctgcgttcactatctgcttcag
cacggggcggccctcaacactcagacacgcaatggctccacaccgctgcacctggcagcc
cgggagggcctgctgagctgtgtcaaggtcctggtgaagaatggcgccaatgtccatgcc
cgagatgccataggctgcaagcccatcgactattgcaaaatatggaaccaccgcgtctgt
gctcggttcttgaaggatgccatgtggaaacgggacaagaaggactttgcctatgagatg
gggaagctgaaggggctcaaaggccgcctggcccttatgcagcggtactacctgactgag
taccaggaagaacaacaacttctgagacaagctgatttcaagaagtggctccatcataag
ccactgcctcgaggccaatctctgatccacagcattgagcaagagcccccagccccttcc
agggccatccccgtctccaagacccccaagctgtccaagcacttccacctcttcccacag
gagcacctgcaacagacatcacagcccaagctgcagccctcggtgtcatccacaccccac
tacaggcatcccacagttaggcagcccaagccatggaatattagcaacaaccctgccaga
tcccccaccgcccagattggctccccacagggcatccgcctgggtgtgaatccagacccc
agccttgagcacaacttgagcggattcctcaagatcaggtctgatgggcaaggtggtacg
cacttgtgcacggtgactggcaagcaggtggcccctgtgcctcggctgcctttggaggtg
atagtccgtgagctgtaccctcacatgcggccgtgcaggatgaaggtgccccagggcttc
cactctgtcagcatacaggatgtggaccggaagcggtacttgggcgacaacaccttttgg
accgacactctggccatgaacttacgtgaaacatttgacgaagccttcctggcagcagtg
caagcccaccaggggctccccattctgccctgcccctaa

DBGET integrated database retrieval system