KEGG   Myotis davidii: 102754618
Entry
102754618         CDS       T02992                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myd01009]
    102754618 (AKAP5)
Protein phosphatases and associated proteins [BR:myd01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102754618 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102754618
NCBI-ProteinID: XP_006760160
Position
Un
AA seq 428 aa
METPVSDIQVESKDETRSAEVRAHDERQEGKASMLCFKRRKKSAKAMKPRAGSGAADVAR
KCASGAGASEQPQPPGGAWASIKRLVTRRKRSGSSKQQKPAEAKVQPEVSAEDANLPKKK
AKSRLRIPCIKFSKGEKRHNHSEITEDADCSIQVQGEAERLDTKTPAKSDDQATETKLTQ
EVSGEVSQKGGDEVCEPNVSNSRTSPGENVISVELGLEKGHSAIQTGTLILEKDIETTEE
TPSIQPQQTSPLETSETEHRLPVVSDAPRSPAIPDQPIAEEARNNVLESEPNGKDHESGE
IVAEEIKPKDNEVSQESDFKETEISAEKPKPEENKKMEPIAIIITDTEISEFDVKKSKNV
PKRFLISMENEEGGGFAECGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASGD
NKINSLLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagacccccgtttctgacattcaagtagaaagcaaggatgagacgagatcagcagaa
gttagagctcatgatgagaggcaggagggaaaagcatcaatgctttgcttcaagagaagg
aagaaatcagccaaagcaatgaagcccagagccggctctggagctgcggacgtggccagg
aagtgtgcgtcaggagctggagcttcggagcagccacagcccccagggggggcctgggcc
tcaataaaacgtcttgtgacacgcaggaaaaggtcaggttcttccaagcagcaaaagccc
gctgaggccaaagtgcaacctgaagtcagtgccgaggatgctaatcttcccaagaaaaag
gcaaaatccagacttaggattccctgcataaaattctcaaagggggagaaaagacataat
cattccgaaattacagaagatgcagactgcagcatccaagttcagggagaggctgaaagg
ttggatacaaaaactccagccaaatcggatgaccaggcaacagagaccaagttgacccag
gaagtaagtggagaggtctcacagaaagggggtgatgaggtctgtgaaccaaatgtgagc
aacagcagaacttctcctggagagaatgtgatttcagtagaacttgggttagaaaagggg
cattctgctattcaaacaggaactctaatccttgaaaaagacattgaaacaactgaggaa
accccaagtatccagccccagcaaacaagcccactggaaacttcagaaacagaacatcgg
ctgccagtggtttctgatgctccccgctctcctgcaatcccagatcaaccaattgcggaa
gaagccagaaacaatgtcctagaaagtgaaccaaatgggaaagaccatgaaagtggagag
attgtagctgaagagattaagccaaaagataatgaagtgagccaggaatcagattttaaa
gaaacggagatcagtgcagagaaacccaaaccggaagaaaacaaaaaaatggagcccatt
gctattattattacagacactgaaatcagtgaatttgatgtcaagaaatctaaaaatgtc
cctaagcgattcttaatttcaatggaaaacgaggaaggagggggttttgctgagtgtggt
tttgagggtagaacttcagaacagtatgaaacactcctaatagaaacagcctcttctctt
gtcaagaatgctatccagttgtctatagagcagctggttaatgaaatggcctctggtgat
aataaaataaacagtcttctacagtga

DBGET integrated database retrieval system