KEGG   Myotis davidii: 102754942Help
Entry
102754942         CDS       T02992                                 

Gene name
MTMR6
Definition
(RefSeq) myotubularin related protein 6
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
myd  Myotis davidii
Pathway
myd00562  Inositol phosphate metabolism
myd01100  Metabolic pathways
myd04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102754942 (MTMR6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102754942 (MTMR6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myd01009]
    102754942 (MTMR6)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     102754942 (MTMR6)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     102754942 (MTMR6)
Protein phosphatases and associated proteins [BR:myd01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    102754942 (MTMR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related DSPc Y_phosphatase Y_phosphatase3 M IFP_35_N
Motif
Other DBs
NCBI-GeneID: 102754942
NCBI-ProteinID: XP_015419860
Position
Un
AA seq 485 aa AA seqDB search
MGVPNSNWQLSDANREYKICETYPRELYVPRIASKPIIVGSSKFRSKGRFPVLSYYHQNK
EAAICRCSQPLSGFSARCLEDEHLLQAISKANPANRYMYVVDTRPKLNAIANRAAGKGYE
NEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVNDFYSGLESSGWLRHIKAVMD
AAIFLAKAIMVENASVLVHCSDGWDRTSQVCSLGSLLLDSYYRTVKGFMVLIEKDWISFG
HKFSERCGHLDGDPKEVSPVFTQFLECVWHLTEQFPQDFEFNEAFLLQIHEHIHSCQFGN
FLGNCQKEREELKLKEKTYSLWPFLLDDQKKYLNPLYSSNSQKFAVLEPNTASFNFKFWR
NMYHQFDRTLHPRESVCNIIMNMNEQNKQLEKDIQDLESKINKRKNEQIDGVLTKELLHP
VHPESPIIKSSLCFKEQTLLPVNDTLRTIEGSNPADNRYSEYAEEFSKSEAAVVSLEYGV
ARMTC
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgccaaattcaaactggcagttgtctgatgccaaccgagaatacaagatttgt
gaaacttatcccagagaactttatgttccccgaatagcaagcaaaccaataattgttggt
agttctaagttccggagcaagggaagatttccagttctttcctactatcatcaaaataag
gaggctgccatttgtcgatgcagtcaaccactgtcgggattcagtgccaggtgtctggaa
gatgaacatttgcttcaagccatcagtaaagccaatccagccaatcgctatatgtatgtc
gtggataccaggcctaaactgaatgcaatagccaacagagcagctggaaaaggttacgaa
aatgaagacaactattctaatattagatttcagtttgttggaattgaaaatattcatgtc
atgcggtccagccttcagaagttattggaagttaatggtaccaaagggctttctgtcaat
gatttctactctggtttggagagctcaggatggcttcgccatatcaaagctgtcatggac
gctgcaatcttcttagccaaagcaataatggtggaaaatgcaagtgtgttggttcattgt
tctgatggctgggatagaacttcccaggtttgttcccttggctctcttttattggattcc
tactacagaacagtcaaaggattcatggttttaatagaaaaggattggatctcctttgga
cataaattttcagagaggtgtggccatttggacggagacccaaaggaagtttcaccagtg
tttactcagttcttggaatgtgtgtggcatttgactgaacagtttccacaagactttgaa
ttcaatgaagcgtttcttcttcagattcatgaacatattcattcatgccaatttggaaac
ttccttggaaattgtcagaaggaaagagaagaactcaagttaaaagagaagacttactcc
ctgtggccatttcttctggatgaccaaaagaagtacttaaatccactgtacagttccaat
tctcagaaatttgctgttttggagccaaatacagcatctttcaattttaagttttggaga
aacatgtaccaccaatttgatcgaacattgcatcccagggagtcagtgtgtaacataatt
atgaatatgaatgagcaaaataaacaattagagaaagacattcaagacttagaatctaaa
attaataaacgcaaaaatgagcaaatagatggagttctcaccaaggaattgttacatcca
gttcatcctgagtcacctatcatcaaaagctccctatgttttaaggagcagactctgtta
cctgtgaatgatactcttcgaactatagagggcagcaacccagcggataatcgttacagt
gaatacgccgaggagttttccaaatctgaagctgctgtggtcagcttagagtatggggtg
gcaagaatgacttgttag

DBGET integrated database retrieval system