KEGG   Myotis davidii: 102755516
Entry
102755516         CDS       T02992                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
myd  Myotis davidii
Pathway
myd04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:myd00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102755516 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:myd04040]
    102755516 (ASIC1)
Ion channels [BR:myd04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102755516 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 102755516
NCBI-ProteinID: XP_006755509
Position
Un
AA seq 526 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFNYHHVTKLDEVAASQLTFPAITLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCQFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPPLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDFF
DSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCV
CEMPCNLTRYAKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQ
KKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADK
GVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggaactgaaggctgaggaggaagaggtgggtggagtccagccggtgagcatccaggcc
ttcgccagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtca
ctaaagcgggcgctctgggccctgtgcttcctgggctcactggctgtgctgctgtgtgtg
tgcacggagcgtgtgcagtactacttcaactaccatcacgtcaccaagctcgacgaggtg
gctgcctcccagctcacctttcctgccatcacgctgtgcaacctcaatgagttccggttt
agccaagtctccaagaatgacctgtaccatgctggggagctactagccctgctcaacaac
aggtatgagataccggacacacagatggcagatgaaaagcagctggagatactgcaggac
aaggccaacttccgcagcttcaagcccaagcccttcaacatgcgcgagttctacgaccgc
gcggggcacgacattcgagacatgctgctctcctgccaattccggggggaggtctgcagc
gcagaagacttcaaggtggtcttcacacggtatggaaagtgctacacgttcaactctggc
cgagacgggcgtcctccgctgaagaccatgaagggagggacgggcaatggactggagatc
atgctagacatccagcaggacgagtacctgcctgtgtggggggagactgacgagacgtcc
ttcgaggctggcatcaaagtgcagatccacagtcaggatgaaccacccttcatcgaccag
ctgggctttggcgtggcccccgggttccagacctttgtggcctgccaggagcagaggctc
atctacctgcccccgccctggggcacctgcaaagcggttaccatggactcggatttcttc
gactcctacagcattaccgcctgccgcatcgactgtgagacccgctacctggtggagaac
tgtaactgccgcatggtgcacatgccaggggacgccccctactgcaccccagagcagtac
aaggagtgtgcggatcctgccctggacttcctggtggagaaggaccaggagtactgtgtg
tgtgaaatgccctgcaatctgacccgctatgccaaggagctgtccatggtcaagatcccc
agcaaagcatccgccaaatacctggccaagaagttcaacaagtctgagcagtacataggg
gagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccattgaacag
aagaaggcctatgagattgcagggctcctgggtgacattgggggccagatggggctgttc
attggcgccagcatcctcacggtgctggagctctttgactacgcctatgaggtcattaag
cacaagttgtgccgacgaggcaagtgccagaaggaggccaaacggagcagcgcagacaag
ggcgtggccctcagcctggatgacgtcaagagacacaacccctgtgagagcctgcggggc
catcctgctgggatgacgtatgctgccaacatcctacctcaccatccggcccgaggcact
tttgaggactttacctgctga

DBGET integrated database retrieval system