KEGG   Myotis davidii: 102755806Help
Entry
102755806         CDS       T02992                                 

Gene name
NPR1
Definition
(RefSeq) natriuretic peptide receptor 1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
myd  Myotis davidii
Pathway
myd00230  Purine metabolism
myd01100  Metabolic pathways
myd04022  cGMP-PKG signaling pathway
myd04024  cAMP signaling pathway
myd04270  Vascular smooth muscle contraction
myd04714  Thermogenesis
myd04921  Oxytocin signaling pathway
myd04923  Regulation of lipolysis in adipocytes
myd04924  Renin secretion
myd04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102755806 (NPR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102755806 (NPR1)
   04022 cGMP-PKG signaling pathway
    102755806 (NPR1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    102755806 (NPR1)
   04921 Oxytocin signaling pathway
    102755806 (NPR1)
   04924 Renin secretion
    102755806 (NPR1)
   04925 Aldosterone synthesis and secretion
    102755806 (NPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102755806 (NPR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102755806 (NPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myd01001]
    102755806 (NPR1)
Enzymes [BR:myd01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102755806 (NPR1)
Protein kinases [BR:myd01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   102755806 (NPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor HNOBA DIRP CHASE6_C YtxC Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 102755806
NCBI-ProteinID: XP_015427160
Position
Un
AA seq 818 aa AA seqDB search
TIPWVPQLPYLERLPVPNTWAFLSDPPPPPPVIYICSSPDAFRALMLLALEAGLSGEDYA
FFHLDLFGQSLQGAQGLGSRRPWERGDGQDVSAHRAFQAAKIITYKEPDNPEYAEFLQQL
KHLAHEQFNFTLEDGLVNTIPASFHDGLLLFVQAATETLAHGGAVTDGEGITQRMWNRSF
QGVTGHLKIDSNGDRETDFSLWDMDPETSAFRVVLNYNGTSQELVAVAGRTLHWPLGYPP
PDIPKCGFDNEDPACNQAHFSTLEVLALVGSLSLLSILIVSIFIYRKMQLEKELASELWR
VRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTVYYKGNLVAVKSV
NRKRIELTRKVLFELKHMRDIQNDHLTRFVGACTDPPNICILTEYCPRGSLQDILENESI
TLDWMFRYSLTNDIVKGMQFLHSGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEP
DQGHTLYAKKLWTAPELLRMASPPVRGSQAGDIYSFGIILQEIALRSGVFHVEGLDLSPK
EIIERVTRGEQPPFRPSLDLQSHLEELGHLMQRCWAEDPQERPPFQQIRTMLRKFNRENS
SNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVEA
EAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMV
VSGLPLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAV
LEEFGGFELELRGDVEMKGKGKVRTYWLLGERGNSTRG
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
acgatcccctgggtgccccagctcccctacctggagcgtctccccgtccccaacacctgg
gcttttctctctgaccctccccctccccccccagtcatctacatctgcagctccccggat
gccttcagagccctgatgcttctggccctggaagctggtctcagtggggaggactatgct
ttcttccacctggatctcttcgggcaaagcctgcaaggtgcacagggccttggctcccgc
aggccctgggagcgcggggatgggcaggatgtcagtgcccaccgggcctttcaggctgcc
aaaatcattacatacaaagagccagataaccctgagtacgcggaattcctgcagcagctg
aagcacttggctcatgagcagttcaacttcaccctggaggacggcctggtgaacaccatc
cccgcgtccttccacgacgggctcctgctcttcgtccaggcagcgacagagaccctggcc
cacgggggagccgtcaccgatggggagggcatcacccagcggatgtggaaccggagcttc
caaggtgtgaccggacacctgaaaatcgacagcaatggagaccgagagactgacttctcc
ctctgggatatggatcctgagaccagtgcctttcgggtcgtcctgaactacaatgggact
tcccaggagctggtggcggtggcagggcgcacactgcactggcccctaggatacccgcct
cctgacatccccaagtgcggctttgacaacgaggaccctgcctgcaaccaagcccacttt
tccaccctggaggtgctggcgctggtaggcagcctctctctgctcagcatcctgatcgtc
tccatcttcatatacaggaagatgcagctggagaaggaactggcctcagagctatggcgg
gtgcgttgggaggacttgcagcccagtagcctggagaggcacctccggagtgcgggcagc
cggctgaccttgagtgggagaggctccaattacggctccctcctcaccacagagggccag
ttccaggtctttgccaagacggtgtattataagggcaacctcgtggctgtgaaaagtgtg
aaccgtaaacgcattgagctgacaagaaaagtcctgtttgagctgaagcatatgcgggat
atacagaatgaccacctgaccaggtttgtgggtgcctgcaccgatccccccaacatctgt
atcctcactgagtactgcccccgtggaagcttgcaggacattctggaaaatgagagcatc
accctggactggatgttccggtactctctcaccaatgacatcgtcaagggcatgcagttc
ctgcacagtggggccatctgctcccacgggaacctcaagtcatccaactgtgtggtagac
ggtcgatttgtgctcaagatcactgactatgggctcgagagcttcagggacccagagcct
gaccaaggacacaccctctacgccaaaaagctgtggacagcccccgagctcctgcgaatg
gcctcaccccccgtccggggctcccaggccggtgacatctacagctttgggatcatcctt
caggagattgccctgagaagcggcgtattccacgtggaaggtttggacctcagccccaaa
gagatcatcgagcgggtgactcggggtgagcagcccccgttccggccctccctggacctg
cagagtcacctggaggaactggggcacctgatgcagaggtgctgggctgaagacccgcag
gagcggccgcccttccagcagatccgcacgatgctgagaaagtttaacagagagaacagc
agcaacatcctggacaacctgctgtcccgcatggagcagtacgccaacaacctggaggag
ctggtggaggagcggacccaggcctacctggaggagaagcggaaggccgaggccctgctc
taccagatcctgcctcactcagtggctgagcagctgaagcgcggcgagaccgtggaggcc
gaagcctttgacagcgtgactatctacttcagtgacattgtgggtttcacagccctgtcg
gccgagagcacacccatgcaggtggtgaccctgctcaatgacctgtacacttgcttcgat
gccgtcatagacaacttcgatgtgtacaaggtggagacgatcggcgacgcctacatggtg
gtgtcggggctcccgctgcgcttgcgcatcggcatccacacaggacccgtgtgtgccggt
gtggtggggttgaagatgccccgttactgtctctttggggacacagtcaacacggcctca
agaatggagtctaacggagaagccctgaagatccacctgtcctcagagaccaaggctgtc
ctggaggagttcggtggtttcgagctggagctccgaggggatgtagaaatgaagggcaaa
ggcaaagttcggacctactggctgctgggggagcgggggaacagcacccggggctga

DBGET integrated database retrieval system