KEGG   Myotis davidii: 102755920Help
Entry
102755920         CDS       T02992                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
myd  Myotis davidii
Pathway
myd04010  MAPK signaling pathway
myd04060  Cytokine-cytokine receptor interaction
myd04068  FoxO signaling pathway
myd04110  Cell cycle
myd04218  Cellular senescence
myd04350  TGF-beta signaling pathway
myd04380  Osteoclast differentiation
myd04390  Hippo signaling pathway
myd04933  AGE-RAGE signaling pathway in diabetic complications
myd05140  Leishmaniasis
myd05142  Chagas disease (American trypanosomiasis)
myd05144  Malaria
myd05145  Toxoplasmosis
myd05146  Amoebiasis
myd05152  Tuberculosis
myd05161  Hepatitis B
myd05166  Human T-cell leukemia virus 1 infection
myd05200  Pathways in cancer
myd05205  Proteoglycans in cancer
myd05206  MicroRNAs in cancer
myd05210  Colorectal cancer
myd05211  Renal cell carcinoma
myd05212  Pancreatic cancer
myd05220  Chronic myeloid leukemia
myd05225  Hepatocellular carcinoma
myd05226  Gastric cancer
myd05321  Inflammatory bowel disease (IBD)
myd05323  Rheumatoid arthritis
myd05410  Hypertrophic cardiomyopathy (HCM)
myd05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102755920 (TGFB2)
   04350 TGF-beta signaling pathway
    102755920 (TGFB2)
   04390 Hippo signaling pathway
    102755920 (TGFB2)
   04068 FoxO signaling pathway
    102755920 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102755920 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102755920 (TGFB2)
   04218 Cellular senescence
    102755920 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102755920 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102755920 (TGFB2)
   05206 MicroRNAs in cancer
    102755920 (TGFB2)
   05205 Proteoglycans in cancer
    102755920 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102755920 (TGFB2)
   05212 Pancreatic cancer
    102755920 (TGFB2)
   05225 Hepatocellular carcinoma
    102755920 (TGFB2)
   05226 Gastric cancer
    102755920 (TGFB2)
   05220 Chronic myeloid leukemia
    102755920 (TGFB2)
   05211 Renal cell carcinoma
    102755920 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102755920 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    102755920 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102755920 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    102755920 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102755920 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102755920 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102755920 (TGFB2)
   05161 Hepatitis B
    102755920 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102755920 (TGFB2)
   05144 Malaria
    102755920 (TGFB2)
   05145 Toxoplasmosis
    102755920 (TGFB2)
   05140 Leishmaniasis
    102755920 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    102755920 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myd04052]
    102755920 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:myd00536]
    102755920 (TGFB2)
Cytokines and growth factors [BR:myd04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102755920 (TGFB2)
Glycosaminoglycan binding proteins [BR:myd00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102755920 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 102755920
NCBI-ProteinID: XP_006761339
Position
Un
AA seq 442 aa AA seqDB search
MHYCVLRAFLLLHWVPAALTLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EDVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSFCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgcgtgctgcgcgcgttcctgctgctgcactgggtgccggccgcgctcacc
ctgtcgacctgcagcaccctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctcagcaagctgaagctcaccagccccccggaagactaccccgagccc
gaggacgtgcccccggaggtcatctccatctacaacagcacccgggacttgctgcaggag
aaggccagccgccgggcggccgcctgcgagcgcgagcgcagcgacgaggagtactacgcc
aaggaggtctacaagatcgacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttaccacaccctctggctcagtgggcagcttctgctccaggcagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaatcgtccgcttt
gacgtctcggcgatggaaaagaacgcttccaacctggtgaaggcggaattcagagtcttc
cgtctacagaaccccaaagccagggtgcccgaacagcggatcgaactgtaccagattctc
aaatccaaggatctgacgtctccaacccagcgctacatcgacagcaaagtggtgaaaaca
agggcagaaggggaatggctttccttcgacgtgaccgacgctgttcacgaatggctccac
cataaagacaggaacctgggatttaaaataagcttacactgtccctgctgcacctttgta
ccgtccaataattacatcatccccaataaaagcgaggaactagaagcgagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttaccctcctacagactggag
tcacaacagtccaaccggcggaagaagcgcgctctagatgcagcctactgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatcttgggtgg
aaatggatccatgaacccaaagggtacaatgccaacttctgtgctggggcatgcccgtat
ttatggagttcagacactcagcacagtagggttctcagcttatataacaccatcaacccg
gaggcatcggcttctccctgctgcgtgtcgcaggacttggaaccgctcaccatcctctat
tacatcggcaagacccccaagatcgaacagctgtccaacatgatagtgaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system