KEGG   Myotis davidii: 102756597Help
Entry
102756597         CDS       T02992                                 

Gene name
SUCLG2
Definition
(RefSeq) succinate-CoA ligase GDP-forming beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
myd  Myotis davidii
Pathway
myd00020  Citrate cycle (TCA cycle)
myd00640  Propanoate metabolism
myd01100  Metabolic pathways
myd01200  Carbon metabolism
Module
myd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102756597 (SUCLG2)
   00640 Propanoate metabolism
    102756597 (SUCLG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myd04147]
    102756597 (SUCLG2)
Enzymes [BR:myd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     102756597 (SUCLG2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     102756597 (SUCLG2)
Exosome [BR:myd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102756597 (SUCLG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA
Motif
Other DBs
NCBI-GeneID: 102756597
NCBI-ProteinID: XP_006770017
Position
Un
AA seq 356 aa AA seqDB search
AKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPKVVGQLAKQMIGYNLTTKQTPKEGVK
VNKLMVAEALNISRETYFAILMDRSCNGPVLVGSPQGGMDIEEVAASSPELIFKEQIDIM
EGIKDSQAQRMAENLGFLGPLKNQAADEIKKLYHLFLKIDATQVEVNPFGETPEGQVVCF
DAKINFDDNAEFRQKDIFAMDDGSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMAT
CDIIFLNGGKPANFLDLGGGVQEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGI
TKACRELELKVPLVVRLEGTNVHEAQRILGSSGLPITSAVDLEDAAKKAVASVAKK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gcaaaagaaattgttttaaaagcccagatcttagctggaggaagaggaaaaggtgtcttt
agtagcggtttgaaaggcggcgttcatttaacaaaagaccctaaagttgtgggacagttg
gctaaacagatgattgggtataacctgacaacgaaacaaactccaaaagaaggtgtgaaa
gttaataagttgatggtcgctgaagccttgaacatttccagggagacctactttgcgatt
ctgatggaccggtcctgcaacggccctgtgctggtgggcagcccccaggggggcatggac
atcgaggaggtggcagcttcaagtccagaacttatttttaaggagcaaattgacattatg
gaagggataaaggacagccaagctcagcggatggcagaaaatttaggcttccttgggcct
ttgaaaaaccaggccgcagatgaaattaagaagctgtatcacctcttcctgaaaatcgat
gctacgcaggtggaagtgaaccccttcggtgagacgccagaaggacaagttgtctgtttt
gatgccaagataaactttgatgacaacgcagaattccgacaaaaggacatattcgccatg
gacgacggatcagagaacgagcccattgaaaatgaagctgccaaatatgacctaaaatac
atcggactggatgggaacattgcctgctttgtgaatggtgctggacttgccatggctact
tgtgatatcattttcctgaacggtgggaagccagccaacttcttggatcttggaggtggc
gtacaggaagctcaagtctatcaagccttcaaattgctcacagctgatcctaaggttgaa
gccatcctcgtcaatatttttggtggaattgtcaactgtgccatcattgccaatgggatc
accaaggcctgccgggagctggaactgaaggtgcctctcgtggtccggcttgaaggaacc
aacgtccacgaggcccagcgcatcctcggcagcagcgggctccccatcacttcggccgtc
gacctggaggacgccgccaagaaggccgtggccagcgtagctaagaagtga

DBGET integrated database retrieval system