KEGG   Myotis davidii: 102757168Help
Entry
102757168         CDS       T02992                                 

Gene name
PIK3C2B
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
myd  Myotis davidii
Pathway
myd00562  Inositol phosphate metabolism
myd01100  Metabolic pathways
myd04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102757168 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102757168 (PIK3C2B)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     102757168 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd C2 PX DUF4135 HEAT_2
Motif
Other DBs
NCBI-GeneID: 102757168
NCBI-ProteinID: XP_006772024
UniProt: L5LDS6
Position
Un
AA seq 1633 aa AA seqDB search
MSSTPGNGEHWESLESVGISRKELAMAEALQMEYDALSRLRHDKEENRTKQNTDPSLIDW
EEPTLDFYNKPAGRQKDLKLLRGLSGSDPTLNYNSLSPQEGLPNHSTSQGSQPGPDPWPK
GSLAGDYLYIFDGSDGGLSLSPRPGDTDGSSKKLSPPPLPPRVSIWDTPPLPPRKRAPSS
SKISQPNDINTFSLVEQPSGKLLGHQILEDAEPRSGGTGRRLGPVDYDGINDAITRLNLK
STYDAEMVRDATRGWKEGRGPLDFGKDTPGKPVARSKTMPPQVPPRTYVSRCANRKNATP
GKNHRISAASVVSRPHAVANGHELFEVSEERDEEVAAFCHMLDVLRSGSDVQDYFLTGYV
WSAVSPSPEHLGDEVNLKVTVLCDSLQEPLTFTCNCSSTVDLLIYQTLCYTRDELRGVNV
GDFVLKPCGLEEFLQNKQALGSHEYIQYCRKFDIDIRLQLMEQKSIRSDLARTVNDDQSP
STLNYLVHLQERPVKQTISRQALSLLFDTYHNEADAFLLADGDFPLKADRVVQSVKAICN
ALAAVETPEITSALNQLPPCPSRLQPKIQKDPTVLAARENREKVMEALTAAILDLVELYC
NTFNADFQTAVHGSHRHDLVQEACHFSGPLAFTVYATHRIPITWAASYEDFYLSCSLSHG
GKELCSPLQTRKAHFSKYLFHLIIWDQRICFPVQVNRLPRETLLCATLYALPTPPPGSSS
EAGKQRRVPEALGWVTTPLFNFRHVLTCGRKLLGLWPATQENSSARWSTPNFHQPDSVIL
QIDFPTSAFDIKFTSPSGDKFSPCYEFGSLREEDQRALKNIMQKECLYWLADADKKRLWE
KRYYCHSEVSSLPLVLASAPSWEWACLPDIYALLKQWTHMNHQDALGLLHATFPDQEVRR
MAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKDG
LKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNTLAKLAQQVREATPSARQGILRT
GLEEVKQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENIRVI
FKCGDDLRQDMLTLQMIRIMNKIWVQEGLDMRMVIFRCFSTGRGKGMVEMIPNAETLRKI
QVEHGVTGSFKDRPLADWLQKHNPGEVEYEKAVENFIYSCAGCCVATYVLGICDRHNDNI
MLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDLC
CQAYNFIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLIE
SSLGSVATKLNFFIHNLAQMKFTGSDDQLTLSFAPRTHTLQRSGRLSDVFLCRQEKVFHP
NKTYIYVVKVMRENSHEATYIQRTFEEFQELHNKLRLLFPSSLLPSFPSRFLIGRPRGEA
GAERRREELNGYIWHLIRATPEVAECDLVYTFFHPLPRDEKATGTSLVPKSSEGSWAQPV
EKVGGEVKLSISYKNNKLFIMVMHIRGLQVLQDGNDPDPYVKIYLLPDPQKTTKKKTKVA
RKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVHIRLRELDLAQEKT
GWFALGSRSHEAS
NT seq 4902 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgactccgggcaatggggaacactgggagtccctggagtccgtgggcatcagc
cgcaaagagctggccatggccgaagccctgcagatggagtatgatgccctgtcccggctc
cggcatgacaaggaggaaaacagaaccaagcagaacacagacccctctctcatcgactgg
gaggaacccacgctggacttctacaacaagccagcaggcagacagaaggacctcaagctc
ttacgcggtctctctggctcggatcctaccctcaattacaactcactctccccacaggaa
gggctgcccaaccactctacctcccagggctcccagcctggcccagatccctggcccaaa
ggctccctggctggagactatctttacatatttgatggttcagatgggggactctctttg
tccccaagaccgggggacacagatggctcttctaagaagctgtccccgcctcctctgcct
cctcgagtctctatctgggacacccctcccctacctcccaggaagagggccccgtcttcc
tccaagatctcccagcccaatgacatcaacactttttctttggtcgaacagccttcaggc
aagttgctagggcatcagatcttagaagacgcggagccaagaagtggggggacagggcgc
cgactggggcctgtggactacgatggtatcaatgatgcgatcacacggctcaacttgaag
tcaacctatgatgcagagatggtgcgggatgccaccaggggctggaaggagggccgggga
cccttggacttcggcaaggacacccctggaaaacccgtggcccggagtaagaccatgccc
ccccaggtgcccccccgcacctatgtctctcgctgtgccaaccggaaaaatgcgacgcct
ggcaagaaccaccggatttctgctgcctcggtggtctcccggccccacgccgtcgccaat
ggccatgagttgtttgaggtgtcagaggagagagatgaggaagttgctgcgttttgccac
atgctggatgtcctccgatcgggctccgacgtccaggactacttcctcaccgggtacgtc
tggagcgctgttagcccgagccccgagcaccttggggatgaggtcaacctgaaggtgacg
gtgttgtgtgacagcctgcaggagccactcacctttacctgcaactgttcctccactgtg
gacttgctcatctaccagaccctgtgctacacccgtgacgaactgcggggcgtgaatgtg
ggtgactttgtgctgaagccctgtgggctggaggagttcttgcagaacaagcaggccctg
ggcagccatgagtacattcagtactgccgcaagtttgacattgacattcggctacagttg
atggagcagaaatccatacgcagcgacttggcccggacggtgaatgatgaccagagcccc
tccactttgaactacctcgtccatctgcaagagaggcccgtcaaacagaccatcagcagg
caggccctgagtctcctgtttgacacttaccacaacgaggcggatgccttcctgctggct
gacggggacttcccgctgaaggctgaccgggtggtccagtccgtcaaggccatctgcaac
gccctggctgccgtggagacccccgagatcaccagtgccctcaaccagctgcccccctgc
ccctcccgcctgcagcctaaaattcagaaggaccccactgtcttggctgccagggaaaac
cgagagaaggtcatggaggctctgaccgcggccatcctggacctggtggagctgtactgt
aacacgttcaacgcagacttccagacggcagtgcacggcagccaccggcacgacctggtc
caggaggcctgccacttctccgggccgctggccttcacggtctatgccacccaccgcatc
cccatcacctgggccgccagctatgaagacttctacctctcctgctccctcagccatggt
ggcaaggagctgtgcagtcccctgcagacccggaaggctcacttctccaagtacctcttt
cacctcatcatctgggaccagcggatctgcttcccagtgcaggtgaaccggctgccccgg
gagacactgctgtgtgccactctctatgctctgcccaccccgccaccggggagctcctcc
gaggccgggaagcagcggcgggtgcctgaggccctgggctgggtcactacccctctcttc
aacttcaggcatgtcctgacctgtggccggaagctcctgggcttatggccagcaacgcag
gaaaactccagcgcccgttggagcactccgaacttccaccagcccgacagcgtcatcctg
cagatcgacttccccacctcggcctttgacatcaagttcaccagcccctctggagacaag
ttcagcccctgctatgagtttggcagcctccgggaggaagaccagcgcgcgcttaaaaac
atcatgcagaaggagtgcctgtactggctcgctgatgctgacaagaagcgcctgtgggag
aagcgatattattgccactcggaggtgagctcacttcccctggtgctggccagcgccccc
agctgggagtgggcttgtctgcccgacatctatgccctcctgaagcagtggacccacatg
aaccaccaggatgccctggggctcctgcatgccaccttcccggaccaggaggtgcggcgc
atggcggtgcagtggatcggctcgctgtcggacgccgagctgctcgactacctgccccag
cttgtgcaggccctgaagtatgagtgctacctggacagccccttggtgcgcttcctcctg
aaacgggccgtctctgacctgcgggtgactcactacttcttctggttgctgaaggacggc
ctcaaggactcccagttcagcatccgttaccagtacctgctggcggccttgttgtgctgc
tgcggcaaggggctgagggaggagtttaaccgccagtgctggctcgtcaacaccctggcc
aagctggcccagcaggtccgggaggccacgccatccgcacggcagggaatcctccgcacg
ggtctggaagaggtaaagcagttctttgccctcaatggctcctgccgcctgcccctcagc
cccagtctgctggttaagggcatcgtgcccagggactgttcctacttcaactccaatgca
gtccccctcaagctctccttccagaatgtggatccactgggggagaacatcagagtcatc
ttcaagtgtggggacgaccttcgtcaggacatgctcaccctgcagatgatccgcatcatg
aacaagatctgggtccaggaggggctggacatgcgcatggtgattttccgctgcttctcc
accggaaggggcaaagggatggtggagatgatccctaatgccgagaccctgcgcaagatc
caggtggagcatggggtgaccggctccttcaaggaccggcctctggccgactggctgcag
aagcacaaccctggggaggtcgagtacgagaaggccgtggagaacttcatctattcctgt
gccggctgctgcgtggccacgtacgtcttgggcatctgtgaccgacacaatgacaacatc
atgctgaagacgactggccacatgttccacatcgatttcggccgcttcctgggccacgcc
cagatgtttggcaacatcaagagggaccgtgccccctttgtcttcacctcggatatggcg
tatgtcatcaacgggggcgacaagccttccagccgcttccatgactttgttgacctttgc
tgccaagcctacaacttcattcgaaagcacacccacctcttcctcaaccttctgggcctg
atgttgtcctgtgggatccctgagctctcagacctggaggacctcaagtatgtgtatgat
gccctgaggcctcaggacacagaggccaatgccactacctactttactaggttgattgag
tccagcttgggcagcgtagccacaaagctcaattttttcatccataacctggctcagatg
aagttcacgggctcagacgaccagctgaccctttcctttgccccccgcacgcacacgctt
cagcgctctggccgcctcagtgatgtctttctctgccgccaggagaaggtcttccacccc
aacaagacctacatttatgtggtaaaggtgatgcgggagaattctcatgaggccacttac
atccagcggacgtttgaggagttccaggagctacacaataagctgcggctgctcttccct
tcttctctcttgcccagcttcccaagtcgcttcctgattggccgcccgaggggagaggcg
ggggccgagcggcggagggaggagctgaacggctacatctggcatttgatccgcgccacc
ccggaggtggccgagtgtgatttggtatataccttcttccaccctctgccccgggatgag
aaggctacgggcaccagcctggtccccaagtcctcagagggctcttgggcccagccggtt
gagaaggtgggaggggaggtgaagctgtccatctcctacaaaaacaataaactcttcatc
atggtgatgcatattcggggcttgcaagtgctccaggacgggaatgaccctgacccctat
gtgaagatttacctccttcctgaccctcagaaaaccactaagaagaaaaccaaagtggcc
cggaaaacgtgcaaccccacctacaatgaaatgctggtgtatgacgggatccccaaggga
gacctgcagcagcgggagctccagctgagtgtgctgagcgagcaaggattctgggagaac
gttctcctcggcgaggtgcacatccgcctgcgggagctggacctggcccaggagaaaacc
ggctggttcgccctgggatcgcggagtcacgaggcctcatga

DBGET integrated database retrieval system