KEGG   Myotis davidii: 102759504Help
Entry
102759504         CDS       T02992                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine palmitoyltransferase 1A
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
myd  Myotis davidii
Pathway
myd00071  Fatty acid degradation
myd01212  Fatty acid metabolism
myd03320  PPAR signaling pathway
myd04152  AMPK signaling pathway
myd04714  Thermogenesis
myd04920  Adipocytokine signaling pathway
myd04922  Glucagon signaling pathway
myd04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102759504 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102759504 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102759504 (CPT1A)
   04920 Adipocytokine signaling pathway
    102759504 (CPT1A)
   03320 PPAR signaling pathway
    102759504 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    102759504 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102759504 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:myd03029]
    102759504 (CPT1A)
Enzymes [BR:myd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102759504 (CPT1A)
Mitochondrial biogenesis [BR:myd03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102759504 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 102759504
NCBI-ProteinID: XP_015424435
Position
Un
AA seq 751 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMSTMYAKIDPSLGIIAKINRTLDTTGSMSSQTKHVVSGVLFGTGLWVALIF
TMRYSLKVLLSYHGWMFAEHGKMSRATKVWMGMVKLFSGRKPMLYSFQTSLPRLPVPAVR
DTVSRYLDSVKPLMKEADFKRMTALAEDFAVSLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMDFLYVLPTHIQAARAGDTIHAILLYRRQLDREELKPILLMGST
VPLCSAQWERMFNTSRIPGEETDTIQHVRDSRHIVVFHKGRDFKVWLYHDGRLLRPRELE
QQIQWILDDPSEPQAGEAKLAALAAGDRVPWARCRQAYFARGKNKQALDAAVEKAAFFVT
LDETEQGYRKEDPDASLDNYAKSLLHGHCLDSSTNTFVSRRWFDKSFTFIVFKNGKIGMN
AEHSWADAPIMGHLWEYVLATDSFQLGYLEDGHCKGDTNPSIPPPSRLQWDIPEECQEVI
QTSLSSASLLAKDVDFHSFPFDAFGKGLIKKSRTSPDAFVQLALQLAHYKDMGKFCLTYE
SQTMEQRLRLFKMASEKHQHMYRLAMTGAGIDRHLFCLYVVSKYLAVESPFLKEVLSEPW
RLSTSQTPLQQPELFDLEKNTEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSC
PDTDSHRFGKHLRQAMTDIIALFGFSSNSRK
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggctcaccaggctgtggccttccagttcacggtcacccccgacggcatcgac
ctgcggctgagtcatgaggccctgaagcagatctatctgtccggacttcattcctggaag
aagaagttcattagattcaagaatggcatcatcaccggcgtgtacccggcgagtccctcc
agttggctcatcgtcgtggtgggcgtgatgtccaccatgtacgccaagatcgacccctcg
ctggggatcattgcgaagatcaaccggaccctggacacgacgggcagcatgtccagccag
acgaagcacgtggtcagcggcgtgctgttcggcacgggcctgtgggtggccctgatcttc
accatgcggtactccctcaaggtgctgctgtcctaccacggctggatgttcgccgagcac
ggcaagatgagccgcgccaccaaagtctggatggggatggtcaagctcttctcaggccgg
aaacccatgctgtacagcttccagacgtccctgccgcgcctgcccgtgcccgccgtgagg
gacaccgtgagcaggtatctggactcggtgaagcccctcatgaaggaagccgactttaag
cggatgacggcgctcgccgaggatttcgccgtcagcctcgggcccaagttgcagtggtac
ctgaagttaaagtcctggtgggctaccaactacgtgagcgactggtgggaggaatacatc
tacctgcgtggacgggggccgctgatggtgaacagcaactactacgccatggattttctg
tacgtgttgcccacgcacatccaggccgccagggcgggcgacaccatccacgcgatcctg
ctgtacaggcgccagctggaccgggaggagctcaaaccgatcctgctcatgggctccacg
gtcccgctctgctccgcgcagtgggagcggatgttcaacacgtctcggatcccgggagag
gagacggacaccatccagcacgtcagggacagccggcacatcgtcgtgttccacaagggc
cgcgacttcaaggtctggctgtaccatgacggccggctgctgcggccccgcgagctcgag
cagcagatacagtggatcctggacgacccgtcggagcctcaggccggggaggccaagctg
gcggccctcgcagcgggagacagggtgccctgggcccgctgccgccaggcctactttgcg
cgtgggaagaacaagcaggcgctggacgccgccgtggagaaggcggccttcttcgtgacg
ctggatgagaccgagcagggctaccggaaggaggaccccgacgcgtccctggacaactac
gccaagtccctgctgcacggccactgcctcgacagttccaccaacacttttgtttcccgc
aggtggtttgacaagtccttcacgtttatcgtcttcaaaaacgggaaaattggcatgaac
gccgagcactcctgggccgacgcgcccatcatggggcacctctgggagtacgtcttggcc
actgacagcttccagctgggctacttggaggatggacactgtaagggggacaccaacccg
agtatcccaccccccagccggctgcagtgggacatcccggaggagtgtcaggaggtgatc
cagacgtccctgagcagcgccagcctcctggccaaggacgtggacttccattccttcccc
ttcgacgccttcgggaaggggctgatcaagaagtcccgcacgagcccggacgccttcgtg
cagctcgccctgcagctggcgcactacaaggacatgggcaagttctgcctcacgtacgag
tcccaaacgatggagcagagactgcgattgttcaagatggcatcggagaaacaccagcac
atgtaccgcctggcgatgacgggcgcggggatcgaccgccacctcttctgcctgtacgtg
gtgtccaagtatctggccgtcgagtctccgttcctgaaggaagtcctgtccgagccctgg
aggctgtccaccagccagacccctctgcagcagccagagctgtttgacttggagaaaaac
acggagtacgtgtccagcggcgggggcttcgggccggttgctgacgatggttacggcgtg
tcctacattctggtgggagagaacctcatcaatttccacatatcctccaagttctcctgc
cctgacacggattctcatcgcttcggaaaacacctgagacaagccatgaccgacatcatc
gctctctttgggttcagctccaactccaggaagtaa

DBGET integrated database retrieval system