KEGG   Myotis davidii: 102759928Help
Entry
102759928         CDS       T02992                                 

Gene name
BLVRB
Definition
(RefSeq) biliverdin reductase B
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
myd  Myotis davidii
Pathway
myd00740  Riboflavin metabolism
myd00860  Porphyrin and chlorophyll metabolism
myd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    102759928 (BLVRB)
   00860 Porphyrin and chlorophyll metabolism
    102759928 (BLVRB)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     102759928 (BLVRB)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     102759928 (BLVRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA 3Beta_HSD Epimerase
Motif
Other DBs
NCBI-GeneID: 102759928
NCBI-ProteinID: XP_015416431
Position
Un
AA seq 203 aa AA seqDB search
MVSSRSPGVPAREPTDLPLCPSLPTGYEVTVLVRDSSRLPSEGPQPAHVVVGDVRQAADV
DKTVAGQDAVIVTLSPLXGPTTVMSEGAQNIVAAMKAHGVDKVVACTSAFLLWDPAKVPP
RLQDVTDDHIRMHKVLQDSGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGH
FMLRCLTTDEYDGHRTYPSHQYD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcctctaggagcccaggagtgccagcccgagagcctactgacctgcctctctgc
ccttctttgcccacaggttatgaggtgacagtgctggtgcgggactcctccaggttgcct
tcggaggggccccagccagcccacgtggtagtgggcgatgttcggcaggcagctgacgtg
gacaagactgtggctgggcaggacgctgtcatcgtgactctgtcccctctannaggtcct
accacagtgatgtccgagggtgcccagaacattgtggcggccatgaaggcccatggtgtg
gacaaggtcgtggcctgcacctcggccttcctgctatgggacccagccaaggtgccccca
cgactacaggatgtgaccgatgaccacatccggatgcacaaggtgctgcaggattcgggt
ctgaagtacgtggccgtgatgccgccccacataggagaccagccactgactggggcctac
actgtgaccctggatggaagaggaccctcaagggtcatctccaaacatgacctaggccac
ttcatgctgcgctgcctcaccaccgacgagtatgatgggcacagaacctacccttcccac
cagtatgactag

DBGET integrated database retrieval system