KEGG   Myotis davidii: 102760572Help
Entry
102760572         CDS       T02992                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase A
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
myd  Myotis davidii
Pathway
myd04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102760572
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:myd03110]
    102760572
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myd04147]
    102760572
Enzymes [BR:myd01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102760572
Chaperones and folding catalysts [BR:myd03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    102760572
Exosome [BR:myd04147]
 Exosomal proteins
  Proteins found in most exosomes
   102760572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 102760572
NCBI-ProteinID: XP_006771141
UniProt: L5LEA5
Position
Un
AA seq 147 aa AA seqDB search
MVNPTVYLDSATDSKPLGRISLELFADKVPKTAENSHALATGEKGFGYKGSCFHRIIPGF
MCQGGDVTRHNGTGGKSVYGEKFEDENFMLKHTGPGILSMANAGPNTNGSQFLICAAKTE
WLDGKHVVFGQVKEGMDIVTAMERSGL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaccccaccgtctacttagacagcgccactgacagcaagcccctgggccgcatc
tccttggagctgtttgcagacaaagttccaaagacggcagaaaactcccatgctctggcc
actggggagaagggatttgggtacaaaggttcctgctttcacagaattattccgggattt
atgtgccagggtggtgacgtcacacgccataatggcacaggcggcaagtccgtctatggg
gagaaatttgaggatgagaacttcatgctgaaacataccggtcctggcatcttgtccatg
gcaaatgctggaccgaacacaaacggctcccagtttctcatctgcgctgccaagacggag
tggttggatggcaagcatgtggtcttcggccaggtgaaggaaggcatggatattgtgaca
gccatggaacgctctggtttatga

DBGET integrated database retrieval system