KEGG   Myotis davidii: 102761508Help
Entry
102761508         CDS       T02992                                 

Gene name
NT5C1B
Definition
(RefSeq) cytosolic 5'-nucleotidase 1B
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
myd  Myotis davidii
Pathway
myd00230  Purine metabolism
myd00240  Pyrimidine metabolism
myd00760  Nicotinate and nicotinamide metabolism
myd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102761508 (NT5C1B)
   00240 Pyrimidine metabolism
    102761508 (NT5C1B)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102761508 (NT5C1B)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     102761508 (NT5C1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5-nucleotidase adh_short adh_short_C2
Motif
Other DBs
NCBI-GeneID: 102761508
NCBI-ProteinID: XP_006767666
Position
Un
AA seq 622 aa AA seqDB search
MSQTSLKQKKKNESATKYSKESLETEKRQESEKSIRLSTPGSQEALPKTESRGYVVRSQW
SGSSRNPSSRVPSAEEARSKPTSLKVEIGMKDGVHDSIMPQSLPQSLAPSMRSIKMHEHH
DHWGHSLIRDRDRDRDRDRDVRDSRDSRDSLHRDCPRTPPLEWKPYSQRRSYSSQDRDYI
ADLGRQRELDNEDEEAYWSSVRTLYEKNPGCSRPRPAKPKHALTIAVSSRALFNMVDGRK
VYEEEGLEKYMEYQLCNENVILTPGPAFRFVKALQHVNARLRDLYPEEHELFDIVLMTNN
HAQVGVRLINSVNHYGLLIDRFCLTGGKSPVGYLKAYLTNFYLSADCEKVQEALQEGIAS
ATMFDGGKDTSYCDSQLRVAFDGDSILFSDELEYPTKDGLEKFFQHETQCETKPIVQEEP
RLDVLINNAGVFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRVVVVSSKL
YKYGDINFEDLNSEQSYNKSFCYSQSKLANILFTRELARRLEGTKVTVNVLHPGIVRTNL
GRHMHIPLLVKPLFNLVSWAFFKTPVEGAQTSVYLASSPEVEGVSGKFFGDCKEEELLPK
AMDESVARKLWDISEVMVGIVQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaacatctctgaaacagaaaaagaagaatgaatctgcaacgaaatactcaaaa
gagagtctagaaacagagaaaagacaggaatctgaaaaatcaattcgtctcagcactccg
ggatcacaagaagcattgccaaagacagagtctcgagggtacgtcgtgcgaagccagtgg
tctggaagttcacggaacccatcctccagagtcccatcagcagaggaagccagaagcaag
cccaccagtcttaaggtagagatagggatgaaggatggagtgcatgatagcataatgccc
cagtccctgcctcagtctctggccccatccatgcgcagcatcaagatgcatgagcaccat
gaccactgggggcacagtctgattcgggatcgggatcgggatcgggatcgggatcgggat
gtccgggattcccgggactcccgggactcgctgcatcgggattgtccacgcacacccccc
ttggagtggaagccctattctcagcgcaggtcctacagctcccaggaccgcgactatata
gctgacctgggccggcagcgggagttggataatgaggacgaggaggcctactggtcatca
gtgaggacactgtatgagaagaacccgggctgctcacgcccccggccggccaaacccaag
cacgccctcaccatcgctgtgtcgtcccgggctctgttcaacatggtggacggcaggaaa
gtctacgaggaggagggtctggaaaagtacatggagtaccagctctgcaacgagaacgtc
atcctgacccccgggcccgccttccgcttcgtcaaggccctgcagcatgtcaatgctaga
ctccgtgatctgtatcctgaagaacacgaattatttgatattgtactgatgactaataac
catgcccaagtgggagtgcggcttataaacagcgtcaatcactatggcttactaattgac
cgcttctgtctgaccggtggcaaaagccctgttggctatttgaaggcatatcttaccaac
ttctatctctctgcggactgtgaaaaagtacaagaagcactgcaagaagggatcgcctct
gcaacaatgtttgacggagggaaagacacgtcttactgtgactcacagctccgtgtggct
tttgatggagactccatcctcttctctgatgagctggaataccctaccaaggatgggctg
gagaaattctttcaacatgaaacacaatgtgagactaagcctattgttcaggaagagccg
agactggacgtcttgatcaataatgcaggggtcttccagtgcccttacatgaagaccgaa
gatgggtttgagatgcagtttggggtgaaccatctgggtcactttttgctcaccaatctt
ctcctgggactgctcaaaagttcagcgcccagcagggtggtggtagtttcttccaaactt
tataaatatggagacatcaactttgaagacttgaacagtgagcaaagctataataagagc
ttttgttacagtcagagcaaactggctaacatcctcttcaccagggaactcgcccgccgc
ctcgaaggcacgaaggtcacggtcaatgtcctgcacccggggatcgtgcggactaacctg
gggaggcacatgcacattccgctgctggtcaagccacttttcaatctggtgtcatgggct
tttttcaaaactccagtagaaggtgcccaaacttcggtttatttagcctcttcaccggag
gtagaaggtgtgtcaggaaagttctttggggattgtaaagaggaagaactgttgccgaaa
gccatggatgagtctgttgcaagaaaactctgggatatcagtgaagtaatggttggcata
gtacagtag

DBGET integrated database retrieval system