KEGG   Myotis davidii: 102761596Help
Entry
102761596         CDS       T02992                                 

Gene name
MAPK4
Definition
(RefSeq) mitogen-activated protein kinase 4
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
myd  Myotis davidii
Pathway
myd04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:myd00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    102761596 (MAPK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myd01001]
    102761596 (MAPK4)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102761596 (MAPK4)
Protein kinases [BR:myd01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102761596 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo RNA_ligase
Motif
Other DBs
NCBI-GeneID: 102761596
NCBI-ProteinID: XP_006763708
Position
Un
AA seq 398 aa AA seqDB search
MAEKGDCFASVYGYDLGGRFVDFRPLGFGVNGLVLSATDSRTCRKVAVKKLTLSDARSMK
HALREVKIIRRLDHDNIVKVYEVLGPKGANLQGELFKFSVAYIVQEYMETDLARLLEQGT
LAEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILDTIPVIREEDKDELLKVMPSFVNSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDILLMAASQSQPSTWDRYPVSLSSD
LEWRPDRCPDARGAGCHMGECEDSKSMNPSKAPDPHPQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaagggggactgctttgccagtgtctacggctatgacctcggtgggcgcttt
gttgacttccgacccctgggcttcggcgtcaacgggctggtgctgtcagccacagacagc
aggacctgccggaaggtggccgtgaagaagctcaccctgagcgacgcccgcagcatgaag
cacgccctccgggaggtcaagatcatccggcgcctggaccacgacaacatcgtgaaggtg
tacgaggtgctggggcccaagggcgccaacctgcagggcgagctgttcaagttcagcgtg
gcctacatcgtgcaggagtacatggagaccgacctggcccgcctgctggagcagggcacg
ctggcggaggagcacgccaagctgttcatgtaccagctgctccgcgggctcaagtacatc
cactcggccaatgtgctgcacagggacctgaagcccgccaacatcttcatcagcaccgag
gacctcgtgctcaagatcggggacttcggcttggcgaggatcgtcgatcagcattattcc
cacaagggttacctgtcagaaggcttggtaacgaagtggtaccgctcaccacgcctgctc
ctctcccctaacaactacaccaaagccatcgacatgtgggcggccggctgcatcctggcg
gagatgctcacagggagaatgctctttgcgggggctcacgagctggagcagatgcagctc
atactggacaccatccctgtgatccgcgaggaggacaaggacgagctgctcaaggtgatg
ccttccttcgtcaacagcacctgggaggtgaagaggcccctgcgcaagctgctccctgaa
gtgaacagtgaagccatcgactttctggagaagatcctgacctttaaccccatggatcgc
ctcacagccgagatggggctgcagcacccctacatgagcccatactcatgccccgaggac
gagcccacctcccagcaccccttccgcattgaggatgagattgacgacatcctgctgatg
gccgccagccagagccagccctccacctgggacaggtaccccgtgagcctgtcatccgac
ctggagtggcggcccgaccggtgcccggacgccagaggtgcaggctgtcacatgggtgag
tgtgaagatagcaagtccatgaatccctccaaggcccccgacccccacccccagtga

DBGET integrated database retrieval system