KEGG   Myotis davidii: 102762536
Entry
102762536         CDS       T02992                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
myd  Myotis davidii
Pathway
myd00230  Purine metabolism
myd01100  Metabolic pathways
myd01522  Endocrine resistance
myd04015  Rap1 signaling pathway
myd04020  Calcium signaling pathway
myd04022  cGMP-PKG signaling pathway
myd04024  cAMP signaling pathway
myd04062  Chemokine signaling pathway
myd04072  Phospholipase D signaling pathway
myd04114  Oocyte meiosis
myd04211  Longevity regulating pathway
myd04213  Longevity regulating pathway - multiple species
myd04261  Adrenergic signaling in cardiomyocytes
myd04270  Vascular smooth muscle contraction
myd04371  Apelin signaling pathway
myd04540  Gap junction
myd04611  Platelet activation
myd04713  Circadian entrainment
myd04714  Thermogenesis
myd04723  Retrograde endocannabinoid signaling
myd04724  Glutamatergic synapse
myd04725  Cholinergic synapse
myd04727  GABAergic synapse
myd04742  Taste transduction
myd04750  Inflammatory mediator regulation of TRP channels
myd04911  Insulin secretion
myd04912  GnRH signaling pathway
myd04913  Ovarian steroidogenesis
myd04914  Progesterone-mediated oocyte maturation
myd04915  Estrogen signaling pathway
myd04916  Melanogenesis
myd04918  Thyroid hormone synthesis
myd04921  Oxytocin signaling pathway
myd04923  Regulation of lipolysis in adipocytes
myd04925  Aldosterone synthesis and secretion
myd04926  Relaxin signaling pathway
myd04927  Cortisol synthesis and secretion
myd04928  Parathyroid hormone synthesis, secretion and action
myd04934  Cushing syndrome
myd04935  Growth hormone synthesis, secretion and action
myd04970  Salivary secretion
myd04971  Gastric acid secretion
myd04972  Pancreatic secretion
myd04976  Bile secretion
myd05032  Morphine addiction
myd05163  Human cytomegalovirus infection
myd05166  Human T-cell leukemia virus 1 infection
myd05200  Pathways in cancer
myd05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102762536 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102762536 (ADCY4)
   04371 Apelin signaling pathway
    102762536 (ADCY4)
   04020 Calcium signaling pathway
    102762536 (ADCY4)
   04072 Phospholipase D signaling pathway
    102762536 (ADCY4)
   04024 cAMP signaling pathway
    102762536 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102762536 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102762536 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102762536 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102762536 (ADCY4)
   04062 Chemokine signaling pathway
    102762536 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102762536 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102762536 (ADCY4)
   04912 GnRH signaling pathway
    102762536 (ADCY4)
   04913 Ovarian steroidogenesis
    102762536 (ADCY4)
   04915 Estrogen signaling pathway
    102762536 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102762536 (ADCY4)
   04921 Oxytocin signaling pathway
    102762536 (ADCY4)
   04926 Relaxin signaling pathway
    102762536 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102762536 (ADCY4)
   04918 Thyroid hormone synthesis
    102762536 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102762536 (ADCY4)
   04916 Melanogenesis
    102762536 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102762536 (ADCY4)
   04927 Cortisol synthesis and secretion
    102762536 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102762536 (ADCY4)
   04270 Vascular smooth muscle contraction
    102762536 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102762536 (ADCY4)
   04971 Gastric acid secretion
    102762536 (ADCY4)
   04972 Pancreatic secretion
    102762536 (ADCY4)
   04976 Bile secretion
    102762536 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102762536 (ADCY4)
   04727 GABAergic synapse
    102762536 (ADCY4)
   04725 Cholinergic synapse
    102762536 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102762536 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102762536 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102762536 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102762536 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102762536 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102762536 (ADCY4)
   04714 Thermogenesis
    102762536 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102762536 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102762536 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102762536 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102762536 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102762536 (ADCY4)
   05163 Human cytomegalovirus infection
    102762536 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102762536 (ADCY4)
Enzymes [BR:myd01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102762536 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102762536
NCBI-ProteinID: XP_006760892
UniProt: L5M406
Position
Un
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLALLAVAWASGRELAADPG
FLTTVLCALGGFSLLLGLASCEQRLQRWTRPLSGLVWAALLALGHGFLFTGGVVSAWDQV
SFFLFVIFTTYAMLPLGMRDATAAGLTSSLSHLLALGLYLGPQLDSRPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAAIEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKTLASFSPQWSLDRSRTPRGLDDEMDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFFLLLFVCFSEHLTRCVLKGPKMLHWLPALSGLVATRP
GLRIALGSATILLIFAMAITSLFFLPAASNCPFRATNVSSMAFNLSWELPGSLPLISIPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLVASCCLFLHSHAWLSDCLVARLYLGSLDS
RPGVLKEPKLMGAISFFIFFFTLLALARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLIRVGPPSAALG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgactcttcagtccccggccgccacccagcgaagacctcttctatgagacctac
tacagcctgagccaacagtacccgctcctgctgctgctgctggtgatcgtgctctgcgcg
ctcctggcgctgctggccgtcgcctgggccagcggcagggagctggccgcagacccgggc
ttcctgaccacagtgctgtgcgcgctgggcggcttctcgctgctgctgggcctggcttcc
tgcgagcagcggctgcagcgctggacgcgtccgctctcgggcctcgtgtgggcagcgctg
cttgcgttaggccatggcttcctattcactgggggcgtggtgagcgcctgggaccaggtg
tcctttttcctctttgtcatcttcactacctacgccatgttgcctctgggcatgcgggac
gccacagctgcgggcctcacctcctccctctcacacctgctggcactcgggctgtatctt
ggacctcaactagactcaagacctgcgctgctgccgcagttggcagcaaacgcggtgttg
ttcctgtgcgggaatgtggcgggagcgtaccacaaggcgctgatggagcgcgcgctgcgc
gccaccttccgcgaggcgctcagctccttgcactcacgccggcggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggcccgagagatgaag
gcagagatcatggcacggctgcaggctggacaggggtcaaggccggagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacacggctggccagtgagtgctccccgaaggagctggtgctcatgctcaatgag
ctctttggcaaatttgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctccgggctgcccctctccttaccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactacgagcagccaccggt
gtggacatcaacatgcgcgtgggtgtgcactcgggcagcgtgctctgtggagtcatcggg
ctgcagaagtggcagtatgatgtctggtcccatgatgtcacactggccaaccacatggag
gcaggtggcgtgccaggacgagtacatatcaccggggctaccctggccctgctggcagga
gcttacgctgtggaggatgcagccatagaacaccgggacccataccttcgggagctaggg
gagcctacgtacctggtcatcgatccccgggctgaggaagaggatgagaagggcactgca
ggagggttgctgtcctctcttgagggccccaagatgcgtccatcactgctgatgacccgc
tacctggaatcctggggtgcagccaagccttttgcccacctgagccacgtagagagccct
gtgtccacctccactcctctcccggagaagaccctggcttccttcagcccccagtggagc
ctggaccggagccgtacaccccggggactagatgatgaaatggacactggggatgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtcaaaggacttc
aacccactgacactttacttccgagagaaggaaatggagaaagagtatcgactctctgca
ctccctgcctttaaatactatgcagcctgcacattcctggtttttctctccaacttcatc
atccagatgctggtgacaaacaggcccccagctctggccatcacctatagcatcaccttc
ctcctcttcttcctcctcctcttcgtctgcttctcagagcacctgacgaggtgcgtcttg
aaaggccccaagatgctgcactggctgcccgcattgtctggcctggtggccacacgtcct
ggactgcgaattgccctgggcagtgccaccatcctcctcatctttgccatggccattacc
agcctgttcttcttaccagcagcatcaaactgcccttttcgggctaccaatgtgtcctcc
atggctttcaacctctcctgggagctccctgggtccctgcctctcatcagtattccatac
tccatgcactgctgcgtgctgggtttcctctcctgctccctctttctgcacatgagcttc
gaactgaagctgctgctgctcctgctatggctggtggcctcctgctgcctcttcctgcac
tcccatgcctggctgtccgactgcctcgtcgcccgcctctatctgggctccttggactcc
aggccaggggtgctgaaggagcccaaactgatgggagctatctccttcttcatcttcttc
ttcacactccttgccttggctcggcagaatgaatattactgccgcctggatttcctgtgg
aagaagaagctgaggcaggagcgggaggaaacagagacaatggagaatctgactcggctg
ctcttggagaacgtgctgcctgcacacgtggccccccagtttattggccagaaccggcgc
aatgaggacctctaccaccagtcctatgagtgtgtctgtgtcctcttcgcctcagtccca
gacttcaaggagttttactctgaatccaacatcaaccacgaggggctagagtgtctgcgc
ctgctcaatgagatcattgctgattttgatgagctgctctctaagcccaagttcagtggg
gtggagaagatcaaaaccatcggcagcacctacatggcagctactggcttaaatgccacc
tctggacaggatgcacagcaggatgctgagcgaagctgcagccacctcggcaccatggtg
gaatttgcagtggcccttgggtctaagctggacgttatcaacaagcactcattcaacaac
ttccgcttgcgtgtggggctaaaccatggaccagtagtggccggagtgataggagcccag
aaaccacaatatgacatctggggcaatacggtgaatgtggccagtcgcatggagagtaca
ggagtcctgggcaagatacaagtgactgaggagacagcccgggccctgcagtccttaggc
tacacctgctacagcaggggcgttatcaaggtcaaaggcaaagggcagctgtgtacctac
ttcctcaacacagatttgataagagttggacctccctcagctgccctaggctga

DBGET integrated database retrieval system