KEGG   Myotis davidii: 102764000
Entry
102764000         CDS       T02992                                 

Gene name
ACY3
Definition
(RefSeq) aminoacylase 3
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102764000 (ACY3)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     102764000 (ACY3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 102764000
NCBI-ProteinID: XP_006771559
UniProt: L5LDG9
Position
Un
AA seq 317 aa
MCSRPEPPLRHVAVVGGTHGNEMSGVYLARYWLRAPGELQRPSFSAVPMLANPVATAACR
RYVDCDLNRAFTSAFLTARAHPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTAGM
GACLIAESAHDVFAMHLCRHLQLQSPELPSRVFLYQLPGEESYSVHSVAKSGLGLELGPQ
PQGVLRADLLVRMRALVAAALDFIQLFNQGTAFPAFEMEAYRKVSSVDFPRTETGDLAGT
VHPQLQDRDFEPLRPGAPIFQMCSGKDVLYEGESTVYPVFINEAAYYEKGIAFLQTEKLT
FSVPALPGLAPAPSPAP
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtgctcacggcctgagcctcccctgcgccatgtggcagtggtcgggggcacccacggc
aatgagatgtctggcgtctacctggcacggtactggctgcgggccccgggggagctgcag
agacccagcttctccgcagtgcccatgctggccaacccagtggccacagccgcctgccgc
cgctacgtggactgtgacctcaaccgcgccttcaccagcgccttcctcacggccagggcc
cacccggatgacccatatgaggtgacaagggcccgagagctgaaccaattgctgggaccc
aaggcctcgggccaggcctttgacttcgtcctggacctgcacaacaccacggccggcatg
ggcgcctgcctcatcgccgaatccgcccacgacgtctttgcgatgcacctgtgccgccac
ctacagctgcagagcccggagctgccctcccgggtcttcctgtaccagttgcccggagaa
gagagctacagcgtccactccgtggccaagagcggactgggcctggagctgggcccccag
cctcagggagtgctgcgggctgaccttctcgtcaggatgagggccttggtggccgcagcc
ctggacttcatccagctcttcaaccagggcaccgcatttcctgcctttgagatggaagcg
tatagaaaagtgagcagcgtggacttcccacgcacggagaccggggacctggcaggcacc
gtgcatcctcagctgcaggaccgagacttcgagccgctgaggcctggagcacccatcttc
cagatgtgcagcggcaaggacgtgctctatgaaggggagtccactgtgtaccccgtgttc
atcaatgaggccgcctactacgagaagggcattgccttcctccagacggagaagctcacg
ttctctgtgcccgccctgcccgggctggcccccgccccctccccagctccctaa

DBGET integrated database retrieval system