KEGG   Myotis davidii: 102764800
Entry
102764800         CDS       T02992                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:myd01002]
    102764800 (ADAMTS13)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102764800 (ADAMTS13)
Peptidases and inhibitors [BR:myd01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102764800 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_CCN TSP1_spondin Reprolysin_3 ADAM_spacer1
Other DBs
NCBI-GeneID: 102764800
NCBI-ProteinID: XP_015427859
Position
Un
AA seq 1340 aa
MDPPSGSVTFVPDQTSFPASPHQLPSLRRWELRPPGTCAWGVLASACLLLGCWGLPGVQG
LLQALGPQEVTSHSGPDATFRGHPSSRLRRHAAAGGVLHLELLVAVGPDVHQAHQEDTER
YVLTNLNMASELLRDPSLGAQFRVHLVRMVILTRPQDAPQLTANITASLLSVCEWSRTVN
PPDDADPAHADLVLYVTRFDLELPDGNRQVRGVTQLGGACSSSWSCLITEDTGFDLGVTI
AHEVGHRWPVTPPVSPQDACQALSCHTDPLDLSSCSRLLFPLLDGTECGPQKWCSKGRCR
SLAELTPMEAVHGHWSAWGPPSPCSRSCGGGVVTRRRQCNNPRPAFGGRACTGADLQAEM
CNTQVCETTQLAFMAEQCAETEGRPLGLSPGNASSYRWGPAVPHSQGDALCRHMCRAVGE
SFIMRRGDSFRDGTRCVPSGPREDGTLSLCVSGSCRTFGCDSRMDSGQVPDECQVCGGDN
STCSLQSGSFMGGRAREYVTFLTLTPNLTRVHIANHRPLFTHLAVRIRGRYVVAGNFSIS
PSTSHPSLLEDSRIEYRVTLTEDRLPRLEEISIPGPTQEDMEIQVYRRYGEEYGNATRPH
VTFTYFQPKLRAWVWAATRGACSVSCGAGEARGRPPPANSEPGRALLCCSLLSWAAGDFG
PCSTSCGTGLRERAVRCVQALGPRLRTLPPARCAALAQKPPCPPRWKVSDACPLACGADL
AAQNVTCAQGVDGLEAPATAGPCSADQTPAALEPCVEVACPPGGGPPDPQPLGEEAAPAP
GGPRLGARAAHVWTPLAGPCSVSCGRGQTELRFVCMDSARGTAVQEELCDLASKPGSRRE
VCQAPCPARWRYKLAACSVSCGGGVARRILYCARAHGQDEDEEILPDTQCQGLPRPEPQE
ACSPEPCPPRWKVTSRGPCSASCGLGTATRSIACVRXXXXXXXEVDGAACAALARPRASI
PCVVADCTYQWHLSTWTQVRPRLGRGERPMRPHTGDPGSFVTVMPGRRWESRHGGRGGHL
ERKTAGLEAGRAAGPQRPRSQIQEGEGRQPDSPRTSRCHPAQHLPRHRRTAGGRAGPPGS
LAVGQTTAGPAAASPEWPQPWARLLSQESPVGAGPCGRQHLEPTGAIDLRGAGQADCAVA
IGRPLGEVLTLQVLESSLNCSAGEMLLLWGRLMWRKACRKLAGLTLSSKANTLVVTQRRG
LSGAPASWATPHHPPLSPAECDTQLFGPRGEIASPLVSSGGRTAGGCRIFIDVAPWARIA
IHALATDMGTEGADASYISIRDVHSLKTTTFRGQQALYWESEGSQAEVEFSQGFLDTHAR
LRGQYWTLQSRAPAPRTAPP
NT seq 4023 nt   +upstreamnt  +downstreamnt
atggacccgcccagcggttctgtcacattcgtccccgaccagaccagcttcccggcatct
ccccaccagctgccttcgctgaggaggtgggagcttcgccccccggggacgtgcgcgtgg
ggagtcctcgcctctgcctgcctcctcctgggctgctggggcctcccgggcgtgcaggga
ctgcttcaggctttggggccccaggaggtgacttcccactccggccctgatgctaccttc
agaggccatccttcctctcgcctccggagacacgctgccgcggggggcgtcctgcacctg
gagctgctggtggccgtcggccccgacgtgcaccaggctcaccaggaggacacggagcgc
tacgtgctgaccaacctcaacatggcgtcggaactgctgagggacccgtccctgggcgcc
cagttccgagtgcacctggtgaggatggtcatcctgacgcggccgcaggacgccccacag
ctcacagccaacatcaccgcgtcgctgctgagcgtctgcgagtggagcaggacggtcaac
cccccggatgacgcggaccccgcgcacgccgacctggtcctctacgtcaccaggtttgac
ctggagctgcctgatggcaaccggcaggttcggggggtcacccagctgggaggtgcctgc
tcctcctcgtggagctgcctcatcactgaagataccggcttcgacctgggggtcaccatt
gcccatgaggtcgggcacagatggcctgtgacgccacctgtgtctcctcaggatgcgtgc
caggcgctctcctgccacacagaccccctggacctcagcagctgcagccgcctcctcttc
ccgctcctggatgggaccgagtgcggcccccagaagtggtgctccaagggccgctgccgc
tccctggcggagctgacccccatggaggcggtgcacgggcactggtcagcttggggtccc
cccagtccttgctcccgctcctgcggaggaggtgtggtcaccaggaggcggcagtgcaac
aaccccagacctgcctttggggggcgtgcttgcacaggtgctgaccttcaggccgagatg
tgcaacacccaggtctgcgagaccacccagctggcgttcatggctgagcagtgtgcggag
accgagggccggccgctgggcctttccccaggcaatgcctcctcctaccgctggggccca
gctgtgcctcacagtcaaggggacgccctgtgcagacacatgtgccgggccgtcggcgag
agcttcatcatgcggcgtggggacagcttccgggacggcacccggtgtgtgccaagcggc
ccgcgggaggacgggaccctcagcctgtgcgtgtcgggcagctgcaggacgttcggctgt
gacagcaggatggactccgggcaggtgccggacgagtgccaggtgtgtggaggggacaac
agcacgtgcagcctgcagagcggctctttcatgggcggaagagcccgagagtacgtcacg
ttcctgacgctgactcccaacctgaccagggtgcacatcgccaaccacaggcctctcttc
acacacctggcggtgaggatccgcgggcgctacgtggtggctgggaatttcagcatctcc
cccagcaccagccacccctccctcctggaggacagccgcatcgagtacagagtgaccctc
accgaggaccggctgccccgcctggaggagatctccatcccgggccccacccaggaagac
atggagatccaggtgtacaggcgctatggcgaggagtatggcaacgccacccgcccgcac
gtcaccttcacctacttccagcctaagctgcgggcctgggtgtgggctgccacgcggggg
gcctgctcggtgagctgtggggcaggtgaggcccggggcaggccccctcctgccaactca
gaacctggcagggctctactctgctgctctctcctcagctgggcagctggagacttcggc
ccctgcagcacctcctgcgggacaggcctgcgggagcgggcggtgcgctgcgtgcaggcc
ctgggcccccgtctgaggacgctgccccctgcccggtgtgcagcgctggcccagaagccc
ccctgcccccccaggtggaaggtgtcggacgcgtgcccgttggcctgtggagcggacctg
gccgcacagaatgtcacgtgcgcgcagggggtggacggcctggaggcgccagcgaccgcc
gggccctgctccgcggaccagacgccagctgccctcgagccctgcgtggaggtggcctgt
cccccgggcgggggccctccggacccccagcctctgggggaagaagctgcacccgcaccg
ggcggccccaggctgggggctcgcgctgcccacgtgtggacgcccctggcggggccctgc
tccgtctcctgtggcagaggccagacggagctgcgtttcgtgtgcatggactccgcccgg
gggacagctgtccaggaagagctgtgtgacctggcgagcaagccggggagccggcgcgag
gtctgccaggctccctgccccgccaggtggcggtacaagctggcggcctgcagtgtgagc
tgtgggggtggggtggcgcggaggatcctgtattgtgcccgggcccacgggcaggacgag
gacgaggagatcctgccggatacccagtgccagggactgcctcggccagagccgcaggag
gcctgcagcccggagccctgcccgcccaggtggaaagtcacgtcccgtggcccatgctca
gccagctgtggcctcggcaccgccacccgctccatagcctgcgtgcggnncnnnnnnnnn
nnnnnnnnngaggttgacggggcggcctgtgcggctctggcacggccgcgggccagcatc
ccctgcgtcgttgccgactgtacttaccagtggcacctcagcacatggacgcaggtgagg
ccgcggctggggcggggagagcgtccgatgaggcctcacacgggggaccccgggagcttc
gtcactgtgatgcccggaaggagatgggagagcaggcatggggggcggggcgggcacctg
gagaggaagacagcaggcctggaggcggggagggcagcgggccctcagaggccgaggtcg
cagatacaggaaggcgagggcagacaacccgattccccccggacaagcagatgccacccg
gcccagcacctccccaggcaccggaggacagcgggaggtagggctgggcctccgggctcg
ctcgcggtgggacagaccacagctggccctgccgccgcttccccggagtggccccagccc
tgggcccgcctcctctcccaggagagccctgtgggggccggtccctgtggccggcagcat
ctcgagccaacaggagccatcgacttgcgaggcgccgggcaggcggactgcgccgtggcc
atcgggcggcccctgggtgaggtgctgaccctccaggtgctggagagctccctcaactgc
agcgccggggagatgctgttactctggggcaggctcatgtggcggaaggcgtgcaggaag
ctggccggcctgaccctcagttccaaggccaacaccctggtggtgacgcagcgccgaggt
ctttcgggggctcctgcatcctgggccacaccccatcatcccccgctctcccctgcagaa
tgtgacacgcagctcttcggcccccggggtgagattgccagcccactggtgagttccggt
gggaggaccgcggggggctgccgcatcttcatcgacgtggctccgtgggcccgtatcgcc
attcacgccctggccactgacatgggcaccgagggagctgatgccagctacatctcgatc
cgggacgtccacagtctgaaaacgaccacattccgcgggcagcaagcgctctactgggag
tcagagggcagccaggcggaggtggagttcagccagggcttcctggacacacatgcccgc
ctgcggggccagtactggacactgcagtccagagctcccgcgccccgcactgccccgccc
tag

DBGET integrated database retrieval system