KEGG   Myotis davidii: 102765185Help
Entry
102765185         CDS       T02992                                 

Gene name
TGFBR1
Definition
(RefSeq) transforming growth factor beta receptor 1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
myd  Myotis davidii
Pathway
myd04010  MAPK signaling pathway
myd04060  Cytokine-cytokine receptor interaction
myd04068  FoxO signaling pathway
myd04144  Endocytosis
myd04218  Cellular senescence
myd04350  TGF-beta signaling pathway
myd04371  Apelin signaling pathway
myd04380  Osteoclast differentiation
myd04390  Hippo signaling pathway
myd04520  Adherens junction
myd04659  Th17 cell differentiation
myd04926  Relaxin signaling pathway
myd04933  AGE-RAGE signaling pathway in diabetic complications
myd05142  Chagas disease (American trypanosomiasis)
myd05161  Hepatitis B
myd05166  Human T-cell leukemia virus 1 infection
myd05200  Pathways in cancer
myd05210  Colorectal cancer
myd05212  Pancreatic cancer
myd05220  Chronic myeloid leukemia
myd05225  Hepatocellular carcinoma
myd05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102765185 (TGFBR1)
   04350 TGF-beta signaling pathway
    102765185 (TGFBR1)
   04390 Hippo signaling pathway
    102765185 (TGFBR1)
   04371 Apelin signaling pathway
    102765185 (TGFBR1)
   04068 FoxO signaling pathway
    102765185 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102765185 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102765185 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    102765185 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102765185 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102765185 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102765185 (TGFBR1)
  09158 Development
   04380 Osteoclast differentiation
    102765185 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102765185 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102765185 (TGFBR1)
   05212 Pancreatic cancer
    102765185 (TGFBR1)
   05225 Hepatocellular carcinoma
    102765185 (TGFBR1)
   05226 Gastric cancer
    102765185 (TGFBR1)
   05220 Chronic myeloid leukemia
    102765185 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102765185 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102765185 (TGFBR1)
   05161 Hepatitis B
    102765185 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    102765185 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myd01001]
    102765185 (TGFBR1)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102765185 (TGFBR1)
Protein kinases [BR:myd01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   102765185 (TGFBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp FTA2
Motif
Other DBs
NCBI-GeneID: 102765185
NCBI-ProteinID: XP_015415942
Position
Un
AA seq 384 aa AA seqDB search
MCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTVGKPSPGLGPVELAAV
IAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGS
GSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIY
QTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALST
ASGLAHLHMEIVGTQVFRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGG
IHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANG
AARLTALRIKKTLSQLSQQEGIKM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatagctgaaatcgacctaattcctcgagacaggccatttgtatgtgcaccatct
tcaaaaactgggtctgttactacaacatactgctgcaatcaggaccactgtaataaaata
gaacttccaactgttggaaagccatcacctggccttggtcccgttgaactggcagctgtc
attgctggaccagtctgcttcgtctgcatctcactcatgttgatggtctatatctgccat
aaccgcactgtcattcaccatcgagtgccaaatgaagaggatccttcattagatcgccct
tttatttcagagggtactacattaaaagatttaatttatgatatgacaacatcggggtct
ggatcaggtttgccattgcttgttcagagaacaattgcaagaactattgtgttacaagaa
agtattggcaaaggtcgatttggagaagtttggagaggaaagtggagaggagaagaagtt
gctgtgaaaatattctcttctagagaagaacgttcatggttccgtgaggcagagatttat
caaactgtaatgttacgtcatgaaaacatcttgggatttatagcagcagacaataaagac
aatggtacatggactcagctctggttggtgtcagattatcatgagcatggatcccttttt
gattatttgaacagatacacagttactgtggaaggaatgataaaactcgctctgtccaca
gcaagtggacttgcccatcttcatatggagattgttggtacccaagtttttaggtacatg
gcccctgaagttctagatgattccataaatatgaaacactttgaatccttcaagcgtgct
gacatctatgcaatgggcttagtattctgggaaatagctcgaagatgttccattggtgga
attcatgaagattaccaactgccttattatgatcttgtaccttctgatccatcagttgaa
gaaatgagaaaagttgtttgtgaacagaagttgaggccaaatattccaaacagatggcag
agctgtgaagccttgagagtaatggctaaaattatgagagaatgttggtatgccaatgga
gcagcaaggcttacagctttgcggattaagaaaactttgtcacaactcagtcaacaggaa
ggcatcaaaatgtaa

DBGET integrated database retrieval system