KEGG   Myotis davidii: 102765943Help
Entry
102765943         CDS       T02992                                 

Gene name
CACNG5
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
myd  Myotis davidii
Pathway
myd04010  MAPK signaling pathway
myd04260  Cardiac muscle contraction
myd04261  Adrenergic signaling in cardiomyocytes
myd04921  Oxytocin signaling pathway
myd05410  Hypertrophic cardiomyopathy (HCM)
myd05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
myd05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102765943 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102765943 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102765943 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    102765943 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102765943 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102765943 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    102765943 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:myd04040]
    102765943 (CACNG5)
Ion channels [BR:myd04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102765943 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 COPI_assoc DUF716 DHHC Claudin_3
Motif
Other DBs
NCBI-GeneID: 102765943
NCBI-ProteinID: XP_006776734
Position
Un
AA seq 275 aa AA seqDB search
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVVLPQNQSTEIRMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNSQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDADTYFSYKYGWSFA
FSAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctgcgggaggaaggcgctgaccctgctgagcagcgtctttgccgtgtgcggc
ctgggcctcctgggcatcgctgtcagcaccgactactggctgtacctggaggagggcgtg
gtcctgccccagaaccagagcacggagatcaggatgtccctgcactcgggcctgtggcgc
gtctgcttcctcgcaggtgaggagcgcggacgctgcttcaccatagagtacgtgatgccc
atgaacagccagctgacatccgagtccacggtcaacgttctgaaaatgattcgctcggcc
acgccgttccctctggtcagtctcttcttcatgttcattgggtttatcctgagcaacatc
gggcacatccgtccgcacaggaccatcctggcctttgtctccggcatcttcttcatcctc
tcgggcctctctctggtggtgggcctggtgctctacatctccagcatcaacgacgagatg
ctcaacaggaccaaggacgcggacacctacttcagctacaagtacggctggtccttcgcc
ttctctgccatctccttcctcttaacggagagcgcgggcgtgatgtccgtgtacctgttc
atgaagaggtacaccgccgaggacatgtacaggcctcaccccggcttctaccgcccgcgg
ctgagcaactgctccgactactcaggccagttcctgcacccagacgcctgggtccggggc
cgcagcccctccgacatctccagcgacgcctcgctgcagatgaacagcaactacccagcc
ttgctcaagtgccctgactacgaccagatgtcgtcctcgccctgctga

DBGET integrated database retrieval system