KEGG   Myotis davidii: 102766243Help
Entry
102766243         CDS       T02992                                 

Gene name
TTN
Definition
(RefSeq) titin
Organism
myd  Myotis davidii
Pathway
myd05410  Hypertrophic cardiomyopathy (HCM)
myd05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:myd00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102766243 (TTN)
   05414 Dilated cardiomyopathy (DCM)
    102766243 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Ig_6 Receptor_2B4 Titin_Z Pkinase fn3_4 C1-set Pkinase_Tyr Adeno_E3_CR1 Ig_4 PPAK THB
Motif
Other DBs
NCBI-GeneID: 102766243
NCBI-ProteinID: XP_015417306
Position
Un
AA seq 32362 aa AA seqDB search
MEAQAPTFKQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQAISTSTLPGVQISFSD
GRAKLTIPAVTKANSGRFSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VRLQVKVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIISTAQISETRQTRIEKKIEAHFDARSIATVEMV
IDGATGQQLPHKTPPRIPPKPKSRSPTPPSVPAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAGRISAPISTSPIRSVKSPSPVRKAQTPAMGQGPEVPPPWKQEGYVASSES
EMRETMVTSATQIRTEERWEGRYGVQEQTTISGAAGAAAAAAKEVKQETDKSAAVATVVA
AVDMARVREPGISAVEQTAQRTTTTAMHIPPAQDQMRKEAETSAVTKAVMAADKAKEQEL
KSRTREIITTKQEQVHVTHEQIRKETEKAFVPKVVISTTTAKEQETRISGEITTKQEQIT
QETIRQTAETTAASMVVLATAKATKLETVLAAQEEIATQQDQMHVTHEKIMKETRKTVVP
KVIVATPKVKEQDLVSRSREGITTKREQIQITQEKMRKEAEKTALSTIAVATAKAKEQET
ILRTRERMATRQEQIQVTHGKVDAGKRAEAVATVVAAVDQARVREPREPGHLEESYAQQT
TLEYGYKEHVSATKIAEQPQRPASEPQVVSKAVKPRVIQAPSETHITTTDQMGMHISSQI
KKTTDVTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSS
QKITKSVKAPTVKPGETRVRAEPTPSPQFPFADTPETYKSQAGIEVKKEVGVSVTGSTVR
EERFEVLHGREAKVTETARVPAPAEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSP
KVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV
QVSEEFEKETTTVTEKFTTEEKRFMESRDVIMTDTSIMEDRAEPGEPAAPFFISKPVVQK
LVEGGSVVFECQVGGNPKPHVYWKKSGVPLTSGYRHKVIYNKQTGECKLVISMTFADDAG
EYTIVIRNKHGETSASASLLGEVIFSIWWHSFVAYHAFDDEGILNTVDSQTQEFHISSFE
ERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVEAGFDLRVKNYRILEGMALIYT
IMPQSVSPRSVSRSPIRMSPARMSPARMSPARMSPGRRLEETDEAQLERLYKPVFVLKPA
SFKCLQGQTARFDLKVVGRPMPETFWFHNGEQVINDYTHKVVIKEDGTQSLIIVPTAPSD
SGEWTVVAQNRAGKSSISVTLTVEAVEHQVKPVFVEKLRNVNIKEGARLEMKVRATGNPN
PDIVWLKNSEIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCK
VNVEVEFAEPEPERRLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPF
FKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDY
GVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEETQLPEGRKGLQRIEELERMAH
EGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPHPKVNWYLNGQLIRKS
KRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIEQREDFRSVLRRAPE
PKPEFHVHEAGKLQFEVQKVDRPVDTTEAKEIVKLKRAERITHEKVSEESEELRSKFKRR
TEEGYYEAITAVELKSRKKDESYEELLKKTKDELLHWTKELTEEEKKALVEEGKITIPTF
KPDRIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRV
YWYWPEDNVCELVIRDVTSEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVV
AKEKDTMATFECETSEPFVKVKWYKDGVEIQSGDKYRMHSDRKVHFLSILTIDAADAEDY
SCVLVEDENVKTTAKLIVEGAVIEFVKELEDIEVPESFSGELECIISPENIEGKWYHNDV
ELKSNGKYSITSRRGRQNLTVKDVTKEDQGEYSFVVDGKKTTCKLKMKPRPIAILQGLSD
QKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGN
YSFTIPALGMSTSGRVSVYSVDVITPLKDVNVLEGTKAVLECKVSVPDVTSVKWYLNDEQ
IKPDDRVQAIVKGTKQRLVINRTHASDEGPYTLMVGRVETSCNLSVEKIKIIRGLRDLTC
TETQNVVLEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVQNMMKDDEGEYTF
YAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVANPDSEGEWLRDGKQLPLSNN
IRSESDGRKRRLIIAASKLDDIGEYTYKVATSKTSANLKVEAVKVKKTLKNLTVTETQDA
VFTVELTHPNVKGLQWIKNGVVLESNDKYDISVKGTVYSLRIKNCTMMDESVYGFKLGRL
GASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVS
ERKVHKLMLQHIAPSDAGEYTAVVGQLECKAKLFVETLHITRTMKSIEVPETKTASFECE
VSHFNVPAMWLKNGVEIEMSEKFKIVVQGKLHQLMIMNTSTEDSAEYTFVCGNDQVSATL
KVTPIMITSMLKDINAEEKDTITFEVTVNHEGISYKWLKNGVEIKSTDRCQMRTKKLTHS
LNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEP
DITVQWMKDGQELQIEDRIKIQKEKYVHRLLIPSARMSDAGQYTVVAGGNMSTANLFVEG
RDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQIQERHQYVVERRIHR
MFISETRHSDAGEYTFVAGKNRSSVTLYVNAPEPPQILQELQPVTVQSGKPARFCAVISG
RPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSA
SLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLTVSWYSKDKKI
KPSRFFRMTQFEDTYQLEIAEAYPEDEGIYTFVANNAVGQVSSTANLRLEAYESILHERI
EEQIEVEMKAAPVIKRRIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSI
RSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFFSRPKSVTTFV
GKTAKFLCTVTGTPVIETIWQKDGVALPPSPNRKISDAENKHILELSNLTVQDRGVYSCM
ASNKFGADICQAELIIIDKPHIIKELEPVQSAINKKIHLECQVDEDRKVTVTWNKDGQKL
PAGKDYKIYFEDKIASLEIPLAKLKDSGTYVCTASNEAGSSSSSATVTIREPPSFVKKVD
PSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELNESNTIRMSFVNSEAVLNITDVKVED
SGSYSCEAVNDVGSDSCSAEIVIKEPPSFIKTLEPADIVRGTNALLQCEISGTGPFEISW
FKDKKQIRSSKKYRLFSQKSLVSLEIFSFNSADVGEYECVVANEVGKCGCSATHLLKEPP
TFVKKVDDFTALAGQTVTFQAAVRGSEPISVSWMKGQEIIKEDGKIKMSFSKGVAVLIIP
DVQISLGGKYTCLAENEAGSQTSVGELIVKEPAKIVERAELIQVTAGDPATLEYTVTGTP
ELTPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYMFEISNEVGSSSCETTF
TVLDRDIAPFFTKPLRNMDSVVSGTCRLDCKIAGSLPMRVSWFKDGKEIASSDRYRIAFV
EGTASLEISRIDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPASKDVLPGSAVC
LKSTFQGSVPLTIRWFKGDKELVSGGSCYITKEALESSLELYSVKTSDSGTYTCKVSNVA
GGVECSANLFVKEPATFVEKLEPSQLLKKGDATQLVCKVTGTPPIKITWFVNDREIKDSS
RHKMSFVESTAVLRLTDVAVEDSGEYMCEAQNEAGSDHCGSILIVKESPYFTKEFKPVEV
LKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFLQDQMVSLQILKFVAADAGEYQ
CRASNDVGSSTCSARVTLREPPTFVKKIESTSSLRGGTAAFQAMLKGSLPIAVTWLKDND
EITEDNNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEE
AVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGQKYKISVTDTVSILKIISTEKT
DSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVSGSHPI
SIQWFKDDQEISASEKYKFSFHDNTAFLEIRHLESTDTGTYTCSATNKAGHNQCSGHLTV
KEPPYFVEEPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTV
LELFSAKAAHSGTYICQLSNDVGIATSKATLFVKEPPQFIKKPSPVLALRNGQSTTFECQ
ITGTPEIRVSWYLDGNEITAIERHGISFIDGLATFQISGARVENSGTYVCEARNDAGTAS
CSIELKVKEPPTFIRELRPVEVVKDSDVELECEVMGTPPFEVTWLKNNKEIRSSKKYTLT
DRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSGNARVSLKEPPSFTKKIENITTVLKSS
ATFQSTVAGSPPISITWLKDDQILDEDDNIHISFVNNVAKLQIRAVDNGHSGRYTCQAKN
ESGVERCYAFLLVQEPAQILEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPS
RYFTMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLNVLDQNIPPSFTKKLT
KMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKHRLVCHENTVALEVYNLELEDT
ANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSAVEFKAVLKGTPPFKIKWF
KDDVELAPGPKCFIGLEGSTSFLNLYSVDASKTGQYTCQVTNDVGSDSCTTMLLVTEPPK
FVKKLETSKIVKAGDSARLECKITGSPEIRVVWYRNEHELPASDKYRTTYLGSSNLKTKK
XKYSMKLNSPIHKKLLFFTEPPVFSSFPPVVETLKNTEVSLECELSGTPPFEVVWYKDKR
QLRSSKKYKIASKNFHASIHILNVETSDIGEYHCKAQNEVGSDTCICTVKLKEPPRFVSK
LNSLTVVAGEPAELQASIEGVQPISVQWLKEKEEVIRESENIRITFVENVATLQFAKAEP
ANAGKYICQIKNDGGMRENMATLTVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSV
EWYKDGKLLTSSQKHKFSFYNKVSSLKILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSD
RMVPPSFTRRLKDTGGVLGTSCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVC
TLQLNSLDMSDMGNYTCVAANVAGSDECRAVLTVQESPSFVKEPEPLEVLPGKNVTFTSV
IRGTPPFKVGWFRGARELVKGDRCNIYFEDTVAELELFNVDLSQSGEYTCVVSNGAGQTS
CTTRLFVKEPAAFVKKLSDHSVEPGKSIILEGTYTGTLPISVTWKKGGVPITPSEKCSVV
TTEKTCILEILNSTKGDAGEYSCEIENEAGRDVCKALVSTLEPPYFVTELEPLEAAVGDS
VSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNLNDSGEYICKAEN
SIGTASSQTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVSWYRDGVLL
RDDDNLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLIAREPKKSPFFDI
KPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGK
GDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIK
VLWFRNDSELHESWKYSMSFVNSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVK
APPVFTQKPAPVGALKGSDVILQCEISGTPPFEVIWVKDRKQVRSSKKFKITSKNFDTSL
HILNLEASDVGEYHCKATNEVGSDTCVCTVKFREPPRFVKKLSDTSTLVGDAVELRAVVE
GFQPISVVWLKDRGEVIRESENTRISFVDNIATLQLSSPEASHAGKYVCQIKNDAGMKEC
SAVLTVLEPARIVEKPEPMTVTTGNPFALECVVAGSPELSAKWFKDGRELSADSKHHITF
INKVASLKIPCAEMSDRGLYSFEVKNSVGKSNCTVSVHISDRVVPPSFIRKLKDTNATLG
ASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQPSFSENVCTLNLSLLEPSDAGTYTCVA
ANVAGSEECSAVLTVQEPPSFEQTPDSVEVLPGMSVTFTSVIRGTPPFKVKWFKGSRELV
SGESCTISLEESVTELELFEVEPLQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLAD
FSVETGSPIVLEATYTGTPPISVSWMKNEFPLAQSPNCSVTMTEKSTILEIVDSTVEDYA
QYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPTTLQCKVDGTPEIRISWYK
EHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKDRKLP
PTFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDSNLQTSFVHNVATLQI
LQTDQSHVGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHV
TGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNAAGKDSC
SALLGVQEPPRFIKKLEPSRIVKQDESTRYECKIGGSPEIRVSWYKDETEIQESSKFRMS
FVDSVAVLEMHHLGVEDSGDYSCEARNAAGSASSSTSLKVKEPPIFRKKPRPMETLKGTD
VHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENFLTSIHILNVDTADIGEYQCKATN
DVGSDTCVGSITLKAPPRFVKKLSDISTVVGEEVQLQTTIEGAEPISVVWFKDKGEIVRE
SDNIWISYSENTATLHFSRAEIANAGKYTCQIKNDAGTQECFATLSVLEPAAIVEKPESI
KVTTGDTCTLECIVTGTPELSTKWFKDGKELTSDSKYKISFFNKVSGLKIINVSPRDSGV
YSFEVQNPVGKDSCTVSVQVSDRTIPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSW
FHEGNEISSGRKYQTTLTDNTCALTVNMLEESDAGDYTCVATNVAGSDECSAPLTVREPP
SFVQKPDAMDVLTGANVTFTSIIKGTPPFSVSWFKGSSELVPGDRCNVSLEESVAELELF
DVDTSQSGEYTCIVTNEAGKASCTTRLHVKAPAKFVKRLNDYSIEKGKALILEGTYTGTP
AISVTWKKNGINIAPSQRCNITTTEKSSILEIPSTAVEDSGQYNCYIENASGKDSCSAQI
QILEPPYFVKQLEPVKVTVGDSASFQCQLAGTPEIVVSWYKGDTKLRPTATYKMHFRNNV
ATLVFNQVGSQDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSRQLRDVQETVGLPVV
FECAVTGSEPLSVSWYKDGKPLKDGPNVQTSFLDKVATLNIFKTDRSLAGQYSCTATNPI
GSASSSARLILTEGKNPPFFDIHIAPVDAVVGDSADFECHVTGTQPIKVSWAKDNREIRS
GGNYQISYLENTAHLTILKVDKGDSGQYTCHAVNEVGKDSCTAQLNIKERLTPPSFTRKL
SETVEETEGNSFKLEGRVAGSQPITAAWYKNNVEIHPTPNCEITFKNNILLLHVKKAGMG
DAGLYTCKVSNDAGSALCTSSVVIKEPKKPPVFDQHLSPVTVNEGEFVQLSCHVQGSEPI
RIQWLKAGKEIKSSDRCSFSFASGTAVLELKDVAKADAGDYVCKASNAAGSDTSKSKVTI
KDKPTAVPTAKKAAVDGKLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQL
NPGGRVSILQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEG
DLRAMLKKAPTLKRGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQ
SQEEETHRLEIEEIEKSEKEEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVF
EIDIKINYPEIKLSWYKGTVKLEPSDKFEISIDGDRHILRVKNCQLKDQGNYRLVCGPHI
ASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVE
HKVHKLTIADVRAEDQGQYTCKHGDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFEC
EVSFDDAIVTWYKGPTELIESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEA
RSTAELYLTTKEIKLEMKPPDIPDSRVPIPTMPIRAIPPEEIPPTAVPPIPVLLPSPEEK
KPPAKRIEVTKKAVKKDTKKVAKPKEEEPPPKVPEVKKPPPPTALIPAKAPEVIDVSSKA
EEVKITTITRQKEVREKKEAVYEKKQAVYEEKKVYIEPLEEPYDELEVEPYTEPFEEPYY
EEPEEDYEETREEAKREVHEEWEEDFEEGQEYYEREEGYDEGEEEWEETYREREVIQVQK
EVYEESHERKIPEKVPEKKKAPPPKVPAVHTKKMVISEEKMFFASHTEEEVSVTVPEVQK
KTVTEEKIHVAVSKKIEPPPKVPEPPKKAAPEVVPVPTPKKVEPPPAKVPEVPKKPVPEE
KKPVPVPKKEPAAPPKVPGVPKKPVPEEKIPVPVAKEKEAPPAEVPEVQKRVVTEEKITI
VTQREESPPPAVPEIPKKKVPEGKRPIPPRKVEEAPPPKVPALPKKPVPEEKVSVPVPVA
KKAPPPRAEVSKKTVLEEKRFAAEEKLSVAVPHKVEVTRHEVSAEEKWSYSEQEERASIS
VYREEEREEEEEEVEVTEYEVLEEPEEYVVEEKLHIISKRVEAEPAEVPEKHEKKIVPKP
KIPAKIEEPLPAKVPEAPKKTVLEKKIPAAVPKKEKVPPAKVPEEPKKPIPEKRVPPKAA
KLEEPPPTKVTERHMQITQEEKVHVAVTKREEPPRARVPEEPKRAVPEEKVLKLKPKKEE
APPATVTEVRKRAVKEEKISIEVPKREPRPTKEVTVTEEKEWSYTREEETVSVHREEEYE
AYEEYDYKEFEEYEPAEEYDQYEDYEERELEHYEESKEYITEPEKPIPVKPVQEEPVPTK
PKAPPTKVVKKAVPEEKVPVPIPKKLKPLPPKVPEESKKVVEEKVRISITKREKEQVTEP
AAKVPMKPKRVVTEEKVLIPKKEVAAPVKVPEAPKRPEPEEITFEEEVVTQVEEYLEEEE
EEEEEYVHEEEYLHEEEEYLHEEEEVITEEVVPVVPVKVPEIPKKPVPEEKKPVPVPKKK
EAPPAKVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVPEEKVPVPVPKKVEAPPAE
VPKKPVPEKKVPVPAPKKVEAPPVKVPEVPKKLIPEEKKPTPVLKKVEAPPPKVPKKREP
APVPVALPREEEVPFEEEIPPEEEVLPEEEEILPEEEEVPPEEEEEEVPPEEEEFVPEDE
VVPEEEEAVPEIKPKVPVPARVPEVKKKVPEKKVIIPKKEEAPPTTVPEVPKKVEERRIV
PPKEEEVPPVEVYEEPEEPIPEEEIPEEPPSIEEVEEVVPPRVPQVVKKAVPEAPTPVPK
KVEAPPAKVPKKVPEEKVPVPVQKKEAPPAKVPEVQKKVPEKKIPEKKVLVPKKEAVPPA
KGRTVLEEKISVAFHKEEVVRERTELEVVEAHVEEALEEEEFHEVEEYFEEEEFHEVEEF
IKVEKQRFEEVHKVEEIHRVIEFLEAEEVEVYEKPKAPPKGPEISEKVIPPKKPPTRVVP
RKEPPAKVPEATKKIVVEEKVHVPEEPKFPPAKVPEAPKEVVPEKKVPLAPPKKPDVPPL
KVPEAPKEVVPEKKVPLAPPKKPEVPPAKAPEVPKAAVPEKKVPEVIPPKPESPPPEVPE
APKEVVPEKKVPVAPPKKPEIPPVKVPEAPKEVVPEKKVPLAPPKKPEVPPAKAPEVPKA
AVPEKKVPEVIPPKPESPPPEVHEEPEEIVSEEPPAELVEEPEPVAPPKVTAPPKKPVPE
KKPPAVVAKKPEPPPMKVPKVPKEVVPEKKEPPVVLKRPEIPPVKVPEVPKEVVPEKKIV
IPKMPEFPPAKVPEVPKKPVLEEKPAVPVPKKVESPPPEVYEEPEEIAPEEEAPVPAVEE
EEPEAPPPAVPEEPKKIVPEKKVPIIKKPEAPPKEPEPEPEKKVIEKPKFKPKPPAPPPA
PPKEDVKEKVFQLKAVSKKVPEKPEVPEKVELKPVKVPGVEKKVRKLLPEPKPQPKEEVV
LKSVLRKRSEEEEPKVEPKKVEKVKKPTVPEPPPKAVEVEAPPTTVAKVEKKIPEPAKVP
EIKPAIPLPGLEPKPKPEPEVKTVKPPPMEPAPAPITAPVTAPVVGKKAEAKPKEEAAKP
KTPIKVGVAKKTPSPVEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTE
AESVGSSAVFECLVSPSTAITTWMKDGSSIRESPKHRFTADGKDRKLHIADVQLSDAGEY
TCVLRLGNKEKTSTAKLIVEELPVRFVKTLEEEVTVVKTQPLYLSCELNKERDVVWRKDG
KIVVEKPGKIVPGVIGLMRALTINDADDFDAGTYTVTVENANNLECSSCVKVVEVIRDWL
VKPIRDQHVKPKGTAVFTCHIARDTPNIKWFKGYDEIPWEPNDKTEIVKEGNYVHLKIKN
ALPEDIDEYAVEIEGKRYPAKLTLGDREVELLKPIEDVTIYEKESASFDAEISEEDVPGQ
WKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAVTTAILTVKEIELDF
AVPLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKSSDKFDIIVDGKKHILVINDSQF
DDEGVYTAEVEGKKTSAQLFVTGVRLQFISPLEDQTVKEGQTATFVCELSHEKMHVVWFK
NDAKLHTSRTVLISSEGKTHKLEIREVTLDDISQIRVQVKDLKSTAHLKVLEADPYFTVK
LHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEIVPSPKHSIKSDGLRRILKIKKAEFSDK
GEYVCDCGTDKTNANVTVEARLIKVEKPLYGVELFVGETARFEIELSEPDVHGQWKLKGE
PLTASPDCEIIEDGKKHILVLYNCQLDMTGEVSFQAANAKSAANLKVKELPLIFITPLSD
VKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRVELIKDGTKHSMVIKSAAFEDEAK
YIFEAEDKHTSAKLIIEGIRLKFLTPLKDVTAKERENAVFTVELSHDNIPVKWFKNDQRL
HTSKRVSMHSEGKTHSITFKNLSLDDTSQIKVEAMGISSEAKLTVLEGDPYFTGKLQDYT
AVEKDEVILQCEISKADAPVKWFKDGEEIKPSKNVVIKADGKKRMLILKKALKSDIGQYT
CDCGTDKTSGKLDIEDREIKLLRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQ
TPDCEIKEEGKVHFLILHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVT
AGETATFDCELSYEDIPVEWYLKGKKLEPSDTVVTRSEGRVHTLTLRDVKLEDAGEVQLT
AKDFKTQANLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEILKSK
KYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVHYACCTKQDAVSLLPVFP
LTISTFNSGEYQWEFFFQLLFKRTDLVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLL
DDEAEYSCEVRAARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYK
GDEEIIETGRYEILTDGRKRILVIQNAQLEDTGSYNCRLPSSRTDGKVKVHELAAEFISK
PQNLEILEGEKAEFVCTISKESFEVQWKRDDKTLESGDKYDIIADGKKRVLVVKDATLQD
MGTYVVMVGAARAAAHLTVIEKLKIIVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEE
AIFDSSKYIILQKDLVYTLRIRDARLDDQASYNVSLTNHRGENVKSAANLIVEEEDLRIV
EPLRDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVAFDNRILYRIDKYKHSLIIKDCGF
PDEGEYIVTAGQDKSVAELLIIEAPTEFVENLEDQTVTEFDDAVFSCQLSREKANVKWYR
NGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRP
PQDILEAPGADVIFLAELNKDKVEVQWLRNNMIIVQGDKHQMMSEGKIHRLQICDIKPRD
QGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGQPLTMVVPYDAYPKAEAEWFKDN
EALSSKTVDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEAFINLEVIDVPGPVRNLE
VTETFDGEVGLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGG
VEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYD
GGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPS
AATPFVKVADPIERPSPPVNLNSSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDK
WIRCNMKLVPELTYKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNM
SAPATVPDPPENVKWRDRTAKSIFLTWDPPKYDGGSRIKGYLVEKCPRGSDRWVACGEPV
AETKMQVTGLEEGQWYSYRVKALNRLGASKPSKPTDEIQAVDTQEAPEIFLDVKLLAGLT
VKAGTKIELPATVTGKPEPKITWTKADKLLKQDNRITIENVPNKSTVTIADSKRSDTGTY
IIEAVNACGRATAVVEVNVLDKPGPPAAFDITEVTNESCLLTWNPPRDDGGSKVTNYVVE
RKATDSDMWHKLSSTVKDTNFKATKLTPNKEYLFRVAAENMYGVGEPVQATPITAKFQFD
PPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVKCNKMPIKDTT
YRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDVGKTSLV
LSWTKPEHDGGAKIESYVIEMLKTGTDDWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVN
KAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVE
KRDVRRKGWQTVDTTVKDTKCTVTPLTEGALYVFRVAAENAIGQSDYCEIEDSVLAKDTF
TTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGRTTGPDC
NFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHI
DIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGIVPDKEYVLRVR
AVNAVGVSEPSEISENVVAKDPDCQPTIDLETHDIVVIEGEKLSIPVPFRAVPVPTVSWH
KDGKEVKASDRLTMKSDHFSANLEVPKSVHADAGVYTITLENKLGSATASINVKVIGLPG
PCKDIKASDVTKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLSWSVK
DLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPIDVEVHNPSAEAMTITWK
PPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAG
IGEPSRATPPTKAVDPIDAPKVIMRTSLEVRRGDEIALDATISGSPYPTITWLKDENVLT
PEEMKKRVAPTVRRKKGEVQEEEPFVLPLVERLSIDSSKKGESQLRVRDSLRPDHGQYMI
KAENDHGVAKAPCTVTVLDTPGPPINFVFEDIRKNSVLCKWEPPLDDGGSEIINYTLEKK
DKTKPDSEWIIITSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLTAKDPFE
PPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNRNLLNALKT
NVEGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPVPRVADTSSTTIELE
WEPPAFNGGGEIIGYFVDKQLVGTNEWSRCTEKMIKVRKYTVKEIREGADYKLRVSAVNA
AGEGPPGETGPVTVAEPQEPPSVELDVSVKGGIQIMAGKTLRIPAVVTGRPEPTKVWTIE
EGELDKDRVVIENVGTKSELIIKEALRKDHGRYVITATNSCGSKFAAVRVEVFDVPGPVL
DLKPVVTNRKMCLLNWSDPADDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLE
GQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSD
GGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNAVGESEPS
LPLNVVIQDDEVPPTIKLRLSVRGDTIKVMAGEPVNIPADVTGLPMPKIEWSKNETVIEK
PTDALKITKEEVSRSEAKTEVIIPKAVRQDKGTYTITASNRLGSVFRNVHVEVYDRPSPP
RNLAVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKKSEWEEVTNTAVEKRYGLW
KLIPNGQYEFRVRAVNKYGISDECKSDKVTIQDPYRLPGAPGKPKVLERTKGSMLVSWTP
PLDNGGSPITGYWLEKREEGSAYWSRVSRAPITKVGSKGVEFNVPRLIEGVKYQFRAMAI
NAAGIGPPSEPSDPEVAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIV
EMQEEGTTDWKRVNEPDKLLTACECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPA
TDIQEAPEVFIDIGAQDSLTCQAGTQIRIPXXXXXXAQPKSSWEFDGKAKKAMKDGVHDI
PEDAQVETAENSSVIIIPECKRSHSGKYSITAKNKAGQKTASCRVKVMDVPGPPKDLKVS
DITRGSCRLTWKMPDDDGGDRVRGYVIEKKTIDGKAWTKVNPNCGSTTFLVPDLISEQQY
FFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKSTVHLSWKPPKNDGGS
PVTHYIVECLAWDPTGKKKEAWKQCNRRDVEELEFTAEDLVEGGEYEFRVKAVNEAGVSK
PSATVGPVIIKDQTYVPGPVGTPFLPDNLTNDSCKLTWFSPEDDGGSPITNYVIQKREAD
RRAWTPVTYTVTRHNATVQGLIQGKAYFFRIAAENSIGIGPFVETPHEIVIRDPIRVPYA
PDQPIVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWARVTKEPIHPYTKFRVP
DLLEGCQYEFRVAAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQ
PPRRDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETTYKVTGLRDGQTYKFRVLAVNE
AGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKK
EDREAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPR
DLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERRDVAGAQWSPLSTTSKKKSHWAKHLN
EGNQYLFRVAAENQYGRGPFVETPKPIKAVDPLHPPGPPKDLHHVDVDKTEVSLVWNKPD
RDGGSPITGYLVEYQEEGTKDWIKFKTVPDLECVVTGLQQGKIYKFRVKAENIVGLSLPD
TTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPFPTAKWTSDGSEIKTD
EHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGTKTVAVHLTVLDVPGPPTGPIDIL
DISPEHMTISWKPPRDDGGSPVINYIVEKKDTRKDTWGVVSSGSSKTKLKVPHLQKGSEY
VFRVSAENKMGVGPPLDSTPTVAKHKFNPPSPPGKPVVTDITENSAMLSWTLPKSDGGSP
ITGYYVERREITGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDP
IKACRPIKPPGPPINPKLKDKTKETADLVWTKPLSDGGSPILGYVVECQKAGTTQWNRIN
KDELIRQCAFTVPGLIEGTEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTC
RDVITVRVGQTIHILARVKGRPEPDITWSKEGKVLVREKRVDIIQDLPRVELQIKEAVRA
DHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLRVSHVNKENCTVSWENPLDNGGSEIT
NFIVESRKPNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILA
INPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWERGHKGS
IKETHFMVDKCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVK
AGDTIRLEAGVRGKPFPEVSWTKDKDATDLTRSPRVKIDTSADSSKFSLTKAKRSDGGKY
VITATNTAGSFVAYATVNVLDKPGPVRNLKISDVSSDRCTIRWDPPEDDGGCEIQNYILE
KCESKRMVWSTYSAAVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKFD
RPGRPDPPDVTKVSKEEMTVVWSPPEYDGGKSITGYFLEKKEKHSIRWVPVNKSAIPERR
LKVQNLFPGHEYQFRVKAENEIGIGEPSLPSKPVVAKDPIEPPGPPTNLKVVDTTKNSIT
LGWGKPVYDGGAPIIGYVVEMRPKKEDASPDEGWKRCNAAAQLIRMEFTATSLDENQEYE
FRVCAQNQVGIGRPAELKDAIKPKEILESPEIDLDASMRKLVTVRAGCPIRLFAIVRGRP
APKVTWRRVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTVVNSAGEKAVFVNVR
VLDTPGPVSDLKVSDVTKTSCHISWAPPENDGGSQVTHYIVEKRDAERKTWSTVTPEVKK
LSFQVTNLVPGSEYFFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPKKLEVTEMTKNS
ATLAWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVV
ARNSVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKK
GEDDVVTSSHLVVHKTDTSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVIVMDAPGP
PQPPFDISDIDADACSLSWHIPLEDGGSNITNYVVEKCDVSRGDWVTALASVTKTSCRIG
KLIPGQEYVFRVRAENRFGISEPLTSPKMLAKFPFDVPSEPKNARVTKVNKDCIFVAWDR
PDSDGGSPITGYLIERKERNSLLWVKANDTPVRSTEYPCVGLIEGLEYSFRIYALNKAGS
SPPSKPTEYVTARMPVDPPGKPEVIDVSKSTVSLIWARPKHDGGSKIIGYFVEACKLPGD
KWVRCNTTPHQIPQEEYTATGLEENAQYQFRAIAKTAVNISQPSEPSDPVTILAENVPPR
IELGVAMKSLLTVKAGTNVCLDATVFGKPTPTVSWKKDDTLLKPAEGIKMARKRNLCTLE
LFSVNRKDSGDYTITAENPSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLE
DGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPI
LTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSSITGYLVEKRETQAVNW
TKVNRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDASKAVYARDPLYPPGPPAF
PKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEAKRADSVNWVRCNLPDKLQKTRFEVTGL
MENIEYQFRVYAVNKVGYSDPSDVPDNHCPKDILIPPEGELDADLRKTIILRAGVTLRLY
VPVKGRPPPKITWSKPDANLRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGK
KEYTIVVKVLDTPGPPVNVTVKEISKDSAYITWDPPIIDGGSPIINYVVEKRDAERKSWS
TVATECPKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDLKVRS
VNKSSCTIGWKKPRSDGGSRITGYVVDFLTDENKWQRVMQALNLQYFAKDLIEGKEYTFR
VSAENENGEGTPSEIVVVAKDDVVAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPTPSV
SWKKGEDPLATDTRVSVESSAVNTTLVVRDCQKSDAGKYTITLKNVAGTKEGTLSIKVVG
KPGIPTGPIKFDEVTAEAITLKWGPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTT
FRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVAKHPFDVPDAPPPPNIVDVRHDSVAL
TWTDPRKTGGSPITGYHIEFKERNSLLWKRANKTPIRMKDFRVTGLTEGLEYEFRVMAIN
LAGVGKPSLPSEPVVALDPIDPPGKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRD
LPSKSWMKANHVNVPDCVFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICKDEYE
APTIVLDPTIKDGLTVKAGETIVLSAISILGKPLPKSNWSKAGKDIRLSDVVQITSTPTS
SMLAVKYATRKDAGEYTITATNPFGTKEEHVKVTVLDVPGPPGPIEISNVSAEKATLTWT
PPLEDGGSPIKSYVLEKRETSRLLWTVVAEDIQSCRHVVTKLIQGNEYLFRVSAVNQYGK
GEPVESEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPADDGGSEITGYHVERREKK
SLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSEASNLVLMKDAAYPPG
PPTNAHVTDTTKKSASLAWGKPHYDGGLEITGYIVEHQKVGEEAWIKDTTGTALRITQFV
VPDLQTKEKYNFRISAVNDAGVGEPAVVPDVEIVEREMVPDFELDAELRRTLVVRAGLSI
RIFVPIKGRPAPEVTWTKDDINLKTRANIENTESFTLLIIPECNRYDTGKFVMTIENPAG
KKSGFVNVRVLDTPEPVLNLRPTDITKDSVTLHWDLPLVDGGSRITNYIVEKREATRKSY
TTVTTKCHKCTYKVTGLTEGCEYFFRVMAENEYGIGVPTETTEPVKASEAPLPPESLNIM
DITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVVRNLTEGEEYT
FQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPK
PTVTWKKGDQILKQTQRVNIENTATSTILNINECVRSDSGPYPLTAKNIVGEVGDVVTIQ
VHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVIEMRQTDSTTWTELASTVI
RTTYKATRLTTGVEYQFRVRAQNRYGVGPGITSASIVANYPFKVPGPPGTPQVTAVTKDS
MTISWHEPLSDGGSPILGYHVERKERNGILWQNVSKALVPGNIFKSTGLTDGIAYEFRVI
AENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVE
KRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRD
DIEAPRIMVDIKFKDTIILKAGEAFKLEADVSGRPPPTMEWTKDGKELEGTGKLEIKIAD
FSTTLVNKDSLRRDGGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLVVSDVTSEKCVL
SWLPPRDDGGAKIDHYVVQKRETSRLAWTNVAAEVQVTKLKVTKLLKGNEYIFRVMAVNK
YGVGEPLESEPVLAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERR
DKAGQRWVKCNKKTVTDLRFKVSGLTEGHEYEFRIMAENAAGISAPSSTSPFYKACDAVF
KPGPPGNPRVLDSSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKAT
SYTITNLIENQEYKIRIYAMNSEGIGEPALVPGTPKAEDRLLPPEIELDADLRKVVTIRA
CCTLRLFVPIKGRPAPEVKWSREHGESLDKASIDSTSSYTLLIVGNVNRFDSGKYILTIE
NSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLLDGGSKIKNYVVEKREST
RKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGK
ITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWVTCATVKVTEATITGLIQG
EEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGR
PPPAVTWLKDEVPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATEILN
VVVLDKPGPPTGPVKIDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSAT
VARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPIVAQYPFKVPGPPGTPFVTLSSK
DSMEVRWNEPVNDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFR
VSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYI
VEKKELPEGRWMKASFTNVIDTQFEVTGLVEDHRYEFRVIARNAAGVLSEPSESTGAITA
RDEVDPPRISMDPKYKETIVVHAGEFFKIDADVHGKPIPTTQWLKGDQELSNTTRLEIKS
TDFATSLSVKDAVRIDSGNYILKARNVAGERSVTVNVKVLDKPGPPEGPVVITGVTAEKC
TLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYMFRIMAV
NKYGVGEPLESEPVIAKNPFVVPDAPKAPEITAVTKDSMIVVWERPASDGGSEILGYVLE
KRDKEGIRWTRCHKRLIGELRLRVTGLLENHSYEFRVSAENAAGLSEPSPPSAYQKACDP
IYKPGPPNNPKVTDITRSSVFLSWSKPIYDGGCEIQGYIVEQCDVSDGEWTMCTPPTGIN
KTNLEVEKLLEKHEYNFRICAVNKAGVGEHADVPGPILVEEKLEAPDIDLDLELRKIINI
RAGGSLRLFVPIKGRPTPEVKWGKMDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLT
LENSSGTKSAFVTVRVLDTPSPPVNLKVTDITKDSVSITWEPPLLDGGSKIKNYIVEKRE
ATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPARTADPIKVAEVPQPP
GKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKQSEKWSECARVKSLEAVISNLT
QGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVRPAFNNYSVQVGQDLKIEVPIS
GRPKPTITWTKDGAPLKQTTRINVTDSLDLTVLSIKETHKDDGGHYGITVANIVGQKTAS
IEIITLDKPDPPQGPVKFDEVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWEVVS
ATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFGLDSSPIVAQYPYKEPGPPGTPFVTAI
SKESMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAVNLEEGIEYE
FRVYAENIVGVGKASKNSECYVARDPCDPPGTPEAIIVKRNEITLQWTKPVYDGGSMITG
YIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGTVSKPSDSTGPI
TAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVRGKPLPTIEWLRGDKEVEESARCEI
KNTDFKALLIIKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAE
KCTLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASQVVTNSLKVTKLLEGNEYIFRIM
AVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYI
VEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKAC
DPVFKPGPPTNAHTVDTTKNSITVAWGKPIYDGGSEILGYVVEICTADEEEWQIITPPTG
LKATRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGI
VVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYTHLSIDNCDRNDAGKYI
LKLENSSGSKSAFVTVKVLDTPGPPQNLTVKEVKKDSVILVWEPPIIDGGAKIKNYVIDK
RESTRKAYANVSNKCSKTSFKVENLTEGSIYYFRVMAENEFGVGVPVETVDAVKAAEPPS
TRKGNLLPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKWSVVAESKV
CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLQLPFNTYTVQAGE
DLKIEIPVIGRPRPKISWIKDGETLKQTTRVNIEETATSTILHIKESNKDDFGKYTITAT
NSAGEATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDT
TTTTWQMVSATVARTTIKISKLRTGTEYQFRIFAENRYGKSTPLDSKPVVVQYPFKVPGP
PGTPFVTSISKDQMLVQWHEPVNDGGSKVIGYHLEQKEKNSILWIKLNKSPIQDTKFKTT
GLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNSVTLTWKKPA
YDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFS
EPSESTGAITARDEIDAPNASLDPKYRDVIIVHAGETFVLEADIRGKPIPDIVWLKDGKE
LEETAARMEIKSTLQKTTLIVKDCIRTDGGQYILKLSNVGGTKSIPITVKVRDRPGPPEG
PLKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLL
PGNEYIFRVMAVNKYGIGEPLESEPVIACNPYKPPGPPSPPEVSAITKDSMVVTWTRPVD
DGGAEIEGYILEKRDKEGIRWIKCNKKTLTDLRMRVTGLTEGHSYEFRVAAENAAGVGEP
SEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVKGYVIEVKEATAD
EWTTCTPPTGLQGKQFTVTELKENTEYNFRICAINSEGVGEPATIPGSVVAQDRLEPPEI
ELDADLRKVVILRASTTLRLFVTIKGRPEPEVKWEKADAILTERAQIEVTSSYTMLVIDN
VTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVREVKKDSVTLSWEPPLIDGG
AKITNYIVEKREATRKAYATVTNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPAETT
ESIKASEAPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQ
VKTLEATISGLTTGEEYVFRVAAVNEKGRSDSRQLGVPVIARDIEIEPSVELPFNTFNVK
ARDQLKIDIPFKGRPQATISWKKDDQILKETTRVNVTSSKTVTSLSIKEASREDVGTYEL
CVSNSAGSITVPITVIVLDKPGPPGPIRIDEVSCDNITISWSPPEYDGGCQISNYIVEKR
ETTSTTWHVVSQTVVRTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPP
GPPGTPKVVHATKSTMMVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKILIPNTQMK
VSGLDEGLMYEYRVYAVNIAGIGKCSKACEPVPARDPCDPPGQPEVTNITRKSVSLKWSK
PRYDGGAKITGYIIERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFRVFARNAADS
VSEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVVSWTKDG
VEIEERARIEIVSTDYNTLLTVKDCVRRDTGQYVLTLKNVAGTRSMAVNCKVLDKPGPPA
GPIEINGLTSEKCSLSWGPPQEDGGASIDHYIVEKRETSRLAWTICEGELKTTSCKITKL
LKGNEYIFRVTGVNKYGVGEPLESVAVKALDPFTVPSPPTSLEITSVTKEFMTLCWSRPE
SDGGSEISGYIIERREKSGLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVFAENAAGLSL
PSETSPLIRAEDPVFLPSPPSKPKVVDSGKTNITISWVKPLFDGGAPITGYTVEYKTSDE
TDWTVAIQSLRGTEYTINGLTTGAEYIFRVRSVNKVGASDPSDSSDPQIAKEREEEPVFD
LDSEMKKTLIVKAGASFTMTVPFRGRPVPNVSWSKPDTDLRIRAYIDSTDSRTSLTIENA
NRNDSGKYTLTIQNHLNAVSLTLVVKVLDSPGPPANISVHDVTKESAVLSWDVPENDGGA
PVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVFGENEFGVGVPAETQE
GVKITEKPSPPEKLGVTSVSKDSVSLAWLKPEHDGGSRIVHYLVEALEKGQKNWVKCAVV
KSTHHVVSSLRENSEYFFRVFAENQAGLSDPRELLLPVLVKEQLEPPEIDMKNFPSQTVY
VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEVTAENLTINLKESVAADAGRY
EITAANSSGTTKAFINIIVLDRPGPPTGPIVIGDITEESVTLKWEPPKYDGGSNVTNYIV
LKRETSTAVWTEVSATVARTMIKVMKLTKGEEYQFRIKAENRFGISDHIDSAYVVVKLPY
TTPGPPSTPWINHVTRESITVGWHEPVSNGGNAVIGYHLEMKDRNSILWQKVNKMVIRTT
HFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACEPPRNVRITDISKNSVNLS
WQPPAFDGGSKITGYIVERRDLPEGRWTKASFTNVIETQFTVSGLTQNSQYEFRVFARNA
VGSISNPSEVVGPVTCIDTYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWY
KDDKELQTNALVCVENTTDLASILIKDASRLNSGSYELKLRNEKMGAQSATIRVQILDKP
GPPGGPIEFKTVTAEKMTLLWRPPEDDGGAKITHYIVEKRETSRVVWSMVSENLEECIIT
TTKIIKGNEYIFRVRAVNKYGIGDPLESDPVVAKNAFVTPGPPSIPEVTKITKNAMTVVW
NRPVADGGNEIIGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAA
GQGPFSEPSDFYKAADPIDPPGPPAKIRISDTTKSSITLAWSKPVYDGGSAVTGYVVEMR
QGEEEEWTIVSTKEEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPIVMTEPAQAKDIL
EEPEINLDVAFRTSIIAKAGEDVQVFIPFKGRPPPTVTWRKDDKNLGSDVRYSIQNTDSS
SLLIIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLHIKHVSQGTVTLFW
DPPLIDGGSPIINYVIQKRDATKRTWSAVANKCSSTSFKVTDLSEKTPFFFRVLAENEIG
IGEPCETTEPVKAAEVPAPIRDLSVKDSSKTSVTLSWTKPDFDGGSVITDYVVERKSSTE
QTWSHAGISKTCEIEVGQLKEQSVLEFRVSARNEKGLSDSVSIGPITVKELVITPEVDLS
DIPGAQVTVRIGHNVHLELPYKGKPKPSISWMKDGLPLKESENVRFSKTENKITFNIKNA
KKENGGKYTIILDNAVCRNSFPITVITLGPPSKPKGPIKFDEIKADSVIMSWDVPEDDGG
GEITCYSIEKREASQTNWKMVCSSVARTTFKVPNLVKDSEYQFRVRAENRYGVSQPLVST
IIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYNGGSEVTGFHVEKKERNSILWQRV
NTSPISGREYRATGLIEGLDYQFRVFAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDV
TRETITLKWNPPLRDGGSKIVAYSIERRQGSDRWVRCNFTDVCECQYTVTGLSPGDRYEF
RIIARNAVGTISPPSQSSGFIMTRDENVPPTVEFGPEYFDGLVIKAGESLRIKALVQGRP
VPRVTWFKDEVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYKVEAKNVSGSAKAEITV
KVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPVTHYIVEKRETSRLAWALIEDKC
EAHSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGTPEPSNVTGN
SITMTWARPESDGGNEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLVEGNEYEFR
VMAENAAGIGPASDISRLIKCREPVSPPGAPTVVKVTDTSKTTVSLEWSKPVFDGGMEII
GYIIEMCKAGLEDWHKVNVEACVKTRYTVTDLEAGEEYKFRVSAINGAGKGDSCEVTGTI
KAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPAPTAVWSKPDSNLSIRADIHI
TDSFTTLTVENCNRNDAGKYTLTVENSSGSKSVTFTVKVLDTPGPPGPITFKDVTRGSVT
LMWDAPLLDGGARIHHYVVEKREASRRSWQIISEKCTRQILKVNDLAEGVPYYFRVSAEN
EYGIGEPYEMPEPIIATEQPAPPKRLDIVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQ
KGSDFWVEAGHTKLLTFTVEQLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPT
ADLTGITNQLITCKAGSTFTIDVPISGRPTPKVTWKLEEMRLKETERMSITTTKDRTTLS
VKESMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSISSESCVLSWAEPK
DDGGSEITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKP
LESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTIL
WVKENKVPCLECNYKVTNLVEGLEYQFRTYALNAAGVSKASEASRPVMAQNPVDAPGRPE
VTDVTRSTVSLIWSAPLYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTAL
SEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLV
LDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNAG
GTKAVSVLVKVLDTPGPCGNLTVSRVTEEKCTLAWSLPQEDGGAAITHYVVERRETSRLN
WVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPAETQPIVARNSFTIPSQPGMP
EEVGAGKEHIIIQWLKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTGLM
EGCAYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPM
YDGGADIIGYVLEMQEKDTEQWYRVHTNATIRNTEFTVVDLKMGQKYSFRVAAVNVKGMS
EYSESIAEIEPVERLEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKKGID
LANRAIIDTTDSYSLLIVDKANRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVTV
KEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTVYRISGLIEGIM
YYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRL
TGYVLEASKAGTDRWMKVVTLKPTVLEHTVVSLNEGEQFSFRVRAQNEKGVSEPREIITP
VTIQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLKESERIT
VETQTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKVDEIED
TSVTISWEAPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRTTFKFTRLTEGNEYVFRV
AATNRFGIGSYLQSEIIECRSSISIPGPPETLEIFDVSRDGMTLTWYPPEDDGGSQVTGY
IVERKEVRAERWVRVNKVAVTMTRYRSTGLIEGLEYEHRVTAINVRGTGKPGRPSKPIVA
MDPIAPPGKPQNPRVTDTTRTSVSLAWSPPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTP
TKIREYTLTHLPQGAEYRFRILACNAGGPGEPAEVPGTVKITEMLEHPDVELDERYQEGL
FVRQGGVIRLTIPIKGKPYPICKWTKEGQDISKRAMIATSETHTELVIKEAVRDDSGSYD
LVLENKCGKKAVYIKVKVIGIPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILE
RREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPL
NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITT
TMYTLTGLVPDAEYQFRVIAQNDVGLSETSPASEPIICKDPFDKPSQPGELEILSISRDS
VTLQWEKPECDGGKDILGYWVEYRQSGDSAWKKSNKDRIKDRQFTIGGLLEATEYEFRVF
AENEAGLSRPRRTAMSVKTKLTSGEAPGVRKEMEDVTTKLGEAAQLSCQILGRPLPDIKW
YRFGKELVQSRKYKMSSDGRTHTLTVMTDEQEDEGVYTCIATNEVGETETSSKLLLQATP
QFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAITWFHGQKLLQNSENTAIENTEHYTHL
VMKNVQRKTHAGKYKVQLSNVFGTVDATLDVEIQDKPDKPTGPIVIEALLKNSVVISWKP
PEDDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGI
SNPLEVPSVVIIKSPFEKPSAPGKPTISAVTKESCVVAWKPPASDGGAKIRNYYLEKREK
KQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQ
APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQ
LIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVIS
IKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNR
FGIDQKTVELEVADVPDPPRGVKVSDVARDSVNLTWTEPATDGGSKITNYIIEKCATTAE
RWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTVTKEDKTRAMNYDE
EVDETMEVSMTKASHSSTKELYEKYMIAEDLGRGQFGIVHRCVETSSKKTYMAKFVKVKG
TDQVLVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELTER
EIVSYVRQVCEALEFLHSQSIGHFDIRPENIIYQTRRSSVIKIIEFGQARQLKPGDNFRL
LFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQMIENIRNPEYTF
DEEAFKEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQKTERVSTKVIRTLKHRRYY
HTLIKKDLNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPISGQIMHAVGEEGGYVK
YVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYIKDITKFDDGTYRCKVVND
YGEDSSYAELFVKGVREVYDYYFRRTMKKMKRRTDTMRLLERPPEFTLPLFNKTAYVGEN
VRFGVTITVHPEPRVTWYKSGQKIKPGDDDKKYTFESDKGLYQLTINSVTTDDDAEYAIV
ARNKYGEDSCKAKLTVTPHPPPADTTLRPMFKRLLANAECQEGQSVSFEIRVSGIPPPTL
KWEKDGQPLSLGPTIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE
RLRYVKQEFKSKEERERHVQKQIDKTIRMAEILSGTESVPLTQVAQEALREAAILYKPAV
STKTVKGEFRLETEEKKEERKLRMPYEVPEPRKHKRTVIEEDQRIKQFVPMSDMKWYKKI
RDQFEMPGKIDRIVQKRQKRIRLSRWEQFYVTPLPRFTDQYKPRWRIPKLTQDDLEIVRP
ARRRTPSPDYAFYYRPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFSAS
PPSRSPPRFELSSLRYSSPQAHIKMEETRKDFRYSTYHIPTKADTSTSYAELRERHAQAS
YRQPKQRQRIMAEKEDEELLRPVTTTHRLSEYKSELDHMSKEQKSRKKSKQQRRVTEITE
IEEEYEITKRAQRESSSSVSRLLRRRRSLSPTYIELMRPVSELIRSHPQPAEEYEDDTER
RSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQ
PFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNMS
GVLTLEILDCHIDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASRRRDEDVPRSLFP
DLTKTEAYAVSSFKRTSEMEASSSVREMKSQMTETRESLSSYEHHASAEMKRAAVEEKSL
EEKSTHRKIKSTLEARILTKPRSITVSEGESARFSCDTDGEPVPTVTWLRGGQVISTSTR
HQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGRQEAQFTLTIQKSRVTEKAVTSPPKV
KSPEPQVKSPEGVKSPKRVKSPELVTSPPKAVSPTEKKPTATEKVGQLPVSAPPKISQSL
KAEAVKDIAKLTCAVESSVLCAKEVAWYKDGKKLKENGHFQFHYSADGTYELKIHNLTES
DCGEYVCEISGEGGTSKTNLQFMGQAFKSIHEQVSSVLETKKSAQKTAESTETKVSAQKT
AESTETKVSAQKTAESTETKVSAQKTAESTETKVSAQKTAESTETKVSAQKTAESTETKV
SAQKTAESTEAKVSAQKTAESTETKVSAQKTAESTETKKTETKAPEPISSKPVIVTGLQD
TTVSSDSIAKFSIKVTGEPQPTVIWTKDGKAITQGGKYKLSEDKGGFFLEILKTDTSDSG
LYTCTVTNSAGSVSSSCKLTIKAVKDTETQKVSTQKTSEITSQKAVVQEEISQKALISEE
IKKSEVKSQEKLALTEEASKVTISEKVKKSEAASLEKSIVHEEVTKTSQAMEEISTQVEI
KAFSSQMSITDGQKVTLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKKASH
QHQGILTCIGKTSQGIVKCQYDLSLSEELSDAPAFISQPRSQNVNEGQSVLFSCEISGEP
SPEIEWFKNNLPVSVSSNISVSRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASL
TVLPLVEEPPREVVLKTSDDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFA
SMSAQSMSSMQESFVGMSSSSFMGQSSMTQLASSSSKMLKAGIRGIPPKIEALPSDISID
EGKVLTVACAFTGEPTPEITWSCGGREIQNEDQGRFHIENTEDLTTLIIMDVQKQDGGLY
TLSLGNEFGCDSATVNINIRSI
NT seq 97089 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcaagcaccgacgtttaagcagccgttacaaagtgttgtggtactggagggt
agtactgcaacctttgaggctcacattagtggtttcccagttcctgaggtgagctggttt
cgggatggccaggcaatttccacgtccacgctgcccggcgtgcagatctcctttagcgat
ggccgcgctaaactgacgatccccgccgtgacgaaagccaacagtggacgattctccctg
cgagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagcagaa
acagcgccacccaactttgttcaacgactgcagagcatgaccgtgagacaaggaagccaa
gtgcgactccaagtgaaagtgactggaatccctacacctgtggtgaagttctatcgggac
ggagccgaaatccagagctcccttgattttcaaatttctcaagaaggcgacctctacagc
ttactgattgcggaagcgtaccctgaagactctgggacctattcagtaaatgccaccaat
agcgttggaagagctacttccactgctgaattgctggttcaaggtgaagaagtagtaccc
gctaaaaagacaaagaccattatttcgactgctcagatttcagaaacaagacaaacccga
atagaaaagaagatcgaagcccactttgatgccagatcaattgcaacagttgagatggtc
atagatggtgccaccgggcaacagctgccacataaaacacctcccaggatacctcctaag
ccaaagtcgcggtctcccaccccaccatccgttcctgctaaagcacagttggctcgacag
cagtccccatcgccaataagacactccccttccccggtcagacacgtgcgggcaccaacc
ccatctcctgtcaggtccgtgtccccggccgggaggatctccgcgcccatctccacgtcc
cccatcagatccgtgaagtccccatcacccgtgcggaaggctcagacacccgccatgggc
cagggccccgaggtgcctcccccgtggaagcaagagggctacgtggcctcgtcggagtct
gagatgagagaaaccatggtgaccagtgctactcagatccggacagaggagagatgggag
gggagatacggggtccaggagcaaaccaccatcagcggagctgcgggcgctgccgctgct
gcagctaaagaggtgaaacaagaaactgacaaaagtgcagctgttgcgactgtcgttgct
gcggttgacatggccagagtgcgagaaccaggtatcagcgctgtagagcagactgctcag
aggacaaccacgactgctatgcacatcccacctgctcaagatcagatgagaaaggaagca
gagacatctgctgtaactaaggcagtaatggctgccgacaaagccaaggaacaagaatta
aaatcaagaaccagagaaataattacaacaaaacaagagcaggtgcacgtaactcacgaa
cagataagaaaagaaactgaaaaagcatttgtaccaaaagtagtaatttccacaacaaca
gccaaagaacaagaaactagaatttctggagaaattactacaaaacaagaacaaataact
caagaaacaataagacagacagctgagacaactgctgcatccatggtggtacttgccact
gcaaaggccacaaaactagaaacagttttggcagctcaagaagaaattgccacacagcaa
gatcaaatgcatgtaactcatgaaaagataatgaaagaaactaggaaaacagtggtacct
aaagttatagttgccacacccaaagtcaaagaacaagatttagtgtcaagaagtagagaa
ggcatcactaccaagagagagcaaattcaaataactcaggaaaagatgagaaaggaagct
gagaaaaccgccttgtctacaatagcagttgctactgctaaagccaaagaacaagaaaca
atactgagaactagagaaagaatggctactagacaagaacaaatccaagttactcatgga
aaggtggatgctgggaaaagggcagaagctgtagcaacagttgttgctgcagtcgaccag
gcccgtgtcagagagcccagagagcctgggcatcttgaagaatcgtatgctcagcagact
acattagagtatggctataaggagcatgtttctgccacaaagatagctgagcagccccag
cgtccggcctcagaaccccaggttgtctctaaagcagtcaagcctagagtgatccaagct
ccttcggagactcatatcacaactactgaccagatgggaatgcacatatcatcacagatc
aagaaaactacagatgtaacaactgaaagattagtccatgtggataaacgcccccgcacc
gcaagccctcactttaccgtttcaaagatttctgttcctaaaacagaacatggatatgag
gcatcaatagccggtagcgctattgctactttacaaaaagagttgtcagccacatcttct
cagaagattaccaaatccgtgaaggcacccactgtgaagcctggtgagaccagagtgaga
gcagagcccaccccttcaccccagttccccttcgctgacacaccagagacttacaagagt
caagctggcatcgaagtgaaaaaggaagtaggggtgagcgtcactggtagcacagtccgt
gaagagcgcttcgaagtacttcatgggcgtgaagccaaggtaacagaaacagccagagta
cctgcacctgctgaaatccctgtcactccaccaactttggtctcgggcttaaaaaatgtg
actgttatagaaggtgaatccgtcaccttggagtgccacatctctggatacccatccccg
aaagtgacatggtacagggaagactaccaaatagaaagttccattgatttccagataacc
ttccagagtggaatcgctcgtcttatgattcgggaagcctttgcagaagacagcgggcga
tttacttgcagtgctgtgaacgaggctgggaccgtcagcacatcctgctacctcgctgtg
caggtgtcagaagagtttgaaaaagaaaccacaaccgtgactgagaaatttaccacagaa
gagaaacgctttatggagtcaagagatgtgataatgactgacactagcatcatggaagac
cgagcagaacctggagaacctgctgctcctttcttcatttcaaaaccagtggtccagaaa
ctggtagaaggagggagtgtggtatttgaatgccaggttggcggcaacccaaagccccat
gtctactggaaaaaatctggggttcctctaacctctggatataggcacaaagtgatttac
aacaaacaaactggtgagtgcaaactggtgatttcaatgacttttgccgatgatgctgga
gaatacactattgttattcgtaataagcatggagaaacttctgcatctgcctccttgctt
ggagaagtaatattttctatttggtggcattcatttgttgcatatcatgcctttgatgat
gaagggattctaaatacagttgactcccagacccaggaattccacatttcttcttttgaa
gagaggcttattaaagaaattgaatacaggataataaagactacattagaagaacttctt
gaagaagatggagaagaaaagatggcagttgacatttctgaatctgaagctgttgaagca
ggatttgatttaagagtcaagaattataggattcttgaggggatggccctaatttataca
ataatgccgcaatctgtctctccgcgttcggtgagcaggtctcctatacgcatgtctcct
gcacggatgtcccctgcacggatgtcccctgccagaatgtcccctggacgtaggctggag
gaaacagatgaggcacaactcgagagactgtataagccagtctttgtgttaaagcctgct
tctttcaaatgtttacaagggcaaactgccagatttgacttaaaggttgtgggtagacct
atgccagagaccttctggtttcataatggcgagcaagttatcaatgactatacccataaa
gtggtcattaaagaagatggtacccagtcactgattattgtcccgacagcacccagtgat
tctggggaatggaccgtggttgcccaaaacagggcaggcaaatcttcaatttcagtgact
ttaactgtggaagctgtggaacatcaggttaaaccagtgtttgtggaaaaactgagaaat
gtcaatataaaggagggtgcccgacttgaaatgaaagtcagagctacgggtaaccctaac
cctgacatcgtatggttgaaaaacagtgaaatcattgtacctcataaatatccaaaaatc
agaattgaaggaaccaagggagaagctgcccttaaaattgattccactgtcagccaggat
tctgcctggtatactgccaccgctattaataaggctggccgagatactacacgatgcaaa
gtaaatgtggaagttgagtttgcagagcctgaaccagagagaaggttaatcatcccacgg
gggacatatagagcaaaggaaattgcagccccagaactggagcccttgcatttgcgatat
ggtcaagagcaatgggaggagggtgacctctacgacaaagagaaacaacagaaaccattt
tttaagaaaaaactcacttccttaagactcaagcgctttgggccggcccactttgaatgc
agactaacacccattggtgatccaacgatggtggtggaatggctccacgatgggaagcca
cttgaagcagccaacaggcttcgtatgatcaatgaatttgggtattgcagccttgattac
ggagttgcgtattctcgagacagcggcatcatcacttgcagagccactaacaaatacgga
acagatcacacatctgctacccttattgttaaagatgagaaaagtcttgtggaagaaact
cagttgcctgagggcaggaaaggcttacagagaatcgaagaattagagaggatggctcat
gaaggtgctcttacaggtgtaacgacagatcaaaaagagaagcaaaagccagacatcgtc
ttgttcccagagccagtaagagtacttgaaggggagacggctagattccgctgccgagtg
acaggttaccctcatcccaaagtcaactggtacctcaacggacagctcatccgcaaaagc
aaaaggttccgagttcgctatgatggcattcattacctggacattgtggactgcaaatca
tatgatacaggtgaagtcaaagtcaccgcagaaaatcctgaaggtgtgacggagcataaa
gtgaaacttgagatcgaacagagggaagattttaggtctgtccttcggcgagctcctgaa
ccaaagcccgagtttcacgtacatgaagctgggaaacttcagtttgaggtacaaaaagta
gatagacctgttgacaccaccgaagccaaagaaattgtgaagttgaaaagggccgagcga
atcacccatgaaaaagtgtccgaagaatcagaagagctgcgcagcaagttcaagcgcaga
acagaggaagggtattacgaagccattactgctgtggagctcaagtctcgcaaaaaggat
gaatcctacgaagaactccttaagaagacaaaggatgaacttctccattggaccaaagag
ctaactgaagaggagaagaaagcccttgttgaagaaggcaaaatcactattccaactttt
aaacctgacagaattgaactaagtcctagcatggaagcccccaaaatctttgaaagaatc
caaagccaaacagtgggtcaaggatctgatgcacacttccgggtcagagtcgtgggaaaa
ccagatccggaatgtgaatggtacaaaaacggtgtcaagatcgaacgctctgaccgagtc
tactggtactggcccgaagacaatgtttgcgaactggtcataagagatgtgacttctgag
gactctgccagcatcatggtaaaagccatcaacatagctggggaaacctcaagccacgca
ttcttacttgtccaagccaagcaattgatcactttcacccaggaattacaagatgttgtt
gctaaggaaaaagacaccatggcaacctttgaatgtgaaacttcagagccatttgtcaaa
gtgaaatggtataaagatggagtagagattcagtcgggagataaatacaggatgcactct
gacaggaaggttcacttcctctccattctgaccattgatgcagctgatgctgaagactac
agctgtgtgcttgtggaagatgaaaatgtaaagacaactgccaaacttattgttgaaggt
gcagttattgaatttgtaaaagaacttgaggacatagaagttccagaatcattttcagga
gagttggagtgcattatatccccagaaaacatagaaggcaagtggtatcacaatgatgtg
gagcttaaatccaatggcaagtactcaattacatctcgccgtggacgtcagaacctcaca
gtcaaggatgtgaccaaagaggaccaaggagaatacagctttgttgttgacgggaaaaag
accacttgtaaactcaagatgaaaccccgccccattgctatcctacaaggactcagtgat
cagaaagtctgtgagggcgacattgttcagcttgaagttaaagtctccttggaaaatgtg
gaaggtgtctggatgaaagatggccaagaagtgcagcccagcgacagggttcacattgtg
atcgacaaacagtcacatatgctgctcattgaggacatgacgaaggaggatgctgggaat
tactccttcaccattccagccctgggaatgtcaaccagtgggcgcgtctctgtctatagt
gttgatgtgataacacctctaaaggatgttaacgtgcttgagggtaccaaggctgttctc
gaatgtaaggtctccgtcccggatgtgacttctgttaaatggtatttaaatgatgaacaa
atcaaacctgacgatcgcgtacaagccattgtcaaaggcactaagcagcgactggtgatt
aaccgcacccatgcttccgatgaaggaccttacacgctgatggttggcagagttgaaacc
agctgtaatctctctgtcgaaaaaattaaaattataagaggacttcgtgaccttacctgt
accgaaacccaaaatgtggtccttgaggttgagctgtcccactcaggaattgatgtcttg
tggaattttaaggacaaagaaatcaaacccagttctaaatataaaattgaagctcatgga
aaaatatataagttgacagttcaaaatatgatgaaagatgatgaaggagaatatacattt
tatgctggagaaaacatgacatctggaaaacttactgtggcaggtggggccatctccaag
ccactcacagaccagacagtagctgaatctcaggaagcagtgtttgaatgtgaagttgcc
aaccctgattccgaaggcgaatggctgagggatggcaaacaactgccgctaagcaacaac
atcagaagtgaatctgatggccgcaaaaggagacttatcattgctgccagcaagttagat
gacattggagaatacacctacaaagtggccacctctaaaacatctgctaatctcaaagtt
gaagctgtcaaagttaagaagacgttgaagaacctcacagtgacggagacgcaggacgct
gttttcacagtggagctcacacaccccaatgtgaaaggtctccagtggatcaaaaatggg
gttgtgctggaatccaatgacaagtacgatatctcagtcaaaggaacagtgtactctctg
agaattaaaaactgtaccatgatggatgagtctgtttatggcttcaagctcggaaggcta
ggagccagtgccaggctgcacgttgagaccgtcaagatcattaaaaagccaaaggatgtg
accgccttggaaaatgccaccgttgcctttgaagttagtgtttcccacgacacggttcca
gtaaaatggttccacaagaatgtggagattaagccgagtgacaaacacagactggtctca
gaaaggaaggtccacaaactgatgctacagcatattgccccctcggatgctggggagtat
accgctgtggtgggacaactggaatgcaaagctaaactctttgtggagacattgcatata
acaaggaccatgaagagcatcgaggtgcctgagaccaaaactgcctcctttgagtgcgag
gtgtcccacttcaatgtccctgccatgtggctgaagaatggtgtggagattgagatgagt
gaaaagttcaagatagtggtgcagggaaagctccaccagctgatgatcatgaacaccagc
acagaggactcggcagaatatacatttgtctgtggcaatgaccaagtcagcgccaccctg
aaagtgaccccaatcatgattacgtccatgctgaaggacatcaatgctgaagaaaaagac
accattacctttgaggtgacagtgaaccatgagggcatctcttacaaatggttaaagaat
ggcgtggaaatcaaatcaacggacaggtgccagatgagaaccaaaaagctcacccactcc
ctgaacatcaggaacgttcactttggagatgctgctgattacacctttgtggctggaaag
gctacgtcaacagccaccctttatgtggaagctcgtcatatagaatttaggaaacacatt
aaggacattaaggtgcttgagaagaagcgagccatgtttgaatgtgaagtttctgagcct
gacatcactgtacagtggatgaaagatggccaagagctgcagattgaggacagaatcaag
atacagaaggagaaatatgtccaccgccttctgattccatccgcccggatgtctgatgcc
ggacagtacaccgtggtggcaggaggcaacatgtccactgccaacctctttgttgagggc
agagatgttcgcatccgaagtattaaaaaggaggtccaggttattgagaaacaacgtgct
gttgttgagtttgaggtcaacgaagatgatgttgatgcccactggtataaagatggcatt
gaaatcaatttccaaattcaagagcgacaccagtatgttgtagagcgaagaatccacaga
atgtttatctctgagaccaggcacagcgatgctggtgaatataccttcgtggcaggaaag
aacaggagttctgttaccctctatgtcaatgctccagaaccaccgcaaattctgcaggag
ctccagcctgttactgtgcagtctggcaagcctgcccgcttctgtgctgtgatctctggc
agaccacagcccaaaatttcctggtacaaggaagagcagctgctttccactggcttcaag
tgcaaatttctccacgatgggcaagagtacacacttctgctcattgaggccttcccagag
gacgcagccgtgtacacgtgtgaagccaagaatgactatggagttgccaccacctcagct
tcgctctccgtggaagttccagaggtcgtgtctccggaccaggaaatgcccgtttatcct
cctgccatcatcaccccacttcaggacactgtcacttcggagggacagcccgctcgattt
cagtgcagggtttctggaactgatctaacagtgtcctggtacagcaaggacaagaaaatt
aagccatctaggttcttcagaatgactcaatttgaagacacttaccaactggaaattgct
gaagcttacccagaagatgaagggatttatacttttgttgctaataatgccgtaggtcaa
gtatcaagcacagccaacttgagactggaagcctatgaatcaattttacacgagaggatt
gaagagcagattgaggtggagatgaaagctgcccccgtgatcaagaggagaatcgagccc
cttgaagtagctctgggccacctcgccaagttcacctgtgagatccagagtgcccctaat
gtccgattccagtggtttaaagctggccgagaaatttacgagagtgacaagtgttcgatt
cgatcttcaaattatgtctccagcctggaaattctgagaacccaggttgtggactgcggc
gagtacacctgcaaagcctctaatgagtatggcagtgtcagctgtacagccacactcact
gtgacagaggcatatccaccaacctttttctccagacctaagtccgttacaacctttgtg
ggtaagacagccaagttcctctgcacagtgacagggactcccgtgattgaaaccatttgg
cagaaagatggtgttgctctgccaccttcccctaaccgcaagatttcagatgcagaaaac
aagcacattttagaactctcaaaccttacagttcaagatagaggcgtttactcttgtatg
gcttctaacaagtttggagccgacatctgccaagcagagttaatcataattgacaaacca
catatcattaaggagttagagcctgtgcaatcagctatcaataagaagatccaccttgaa
tgccaagtagatgaagacagaaaagtcacagtgacatggaataaagatgggcaaaaactc
ccagctgggaaagattataagatctattttgaagataaaatagcatcccttgagatccct
cttgccaaactaaaagattcaggaacctatgtttgcacagcctcgaatgaggctgggagc
agttcctcttctgcgacagtaacgatcagagagccaccatcctttgtgaagaaggtggac
ccctcttacttaatgctccctggtgaatcagcacgcctccattgcaagctgaaaggctcc
cctgtgatccaggtcacttggtttaaaaataacaaagaacttaatgagagtaacacaatc
cgaatgtcttttgtcaattcggaggctgtactcaatattaccgatgtaaaagttgaagac
agtgggagttactcatgcgaagcagtgaatgatgttggtagtgacagctgcagtgctgaa
atagttatcaaagaacctccttctttcatcaaaactcttgagcctgcagatatagtgaga
ggaacaaatgccctccttcagtgtgaaatctcgggcacgggaccgtttgaaattagctgg
ttcaaagacaagaagcaaattcgaagtagtaaaaagtacaggttgttttctcagaagtct
cttgtgtctctggagatcttttcttttaatagtgcggacgttggtgaatatgaatgtgtt
gttgctaatgaagtcggcaagtgtggctgcagcgcaacacacttactgaaagaaccacca
acctttgtaaagaaagtagatgactttaccgcactagcaggacaaactgttaccttccaa
gctgctgtgagagggtcagaacccatttctgtctcatggatgaaaggacaagagatcatc
aaagaagatgggaaaatcaaaatgagcttttccaaaggtgtcgcggtcttgataatccct
gatgttcagattagtctgggtggcaaatacacatgcctggctgagaatgaagccggaagc
caaacatctgttggggaattaatagttaaagaacctgccaaaattgttgagcgagcagaa
ctgatccaggtgacagcaggagacccagccaccctggagtatacggtcacaggcacccca
gaactcacgcccaaatggtacaaagacgggagacctttggtggccagtaaaaagtatcga
ataagttttaaaaacaacgttgcccaactcaaattttattcagccgagctgcacgatagt
ggccaatacatgtttgaaatttccaacgaggtgggcagcagctcctgtgagacaactttc
actgtcctagatcgagacattgcgccgttttttaccaaacccctacgcaacatggatagt
gttgtcagcggtacctgcaggctggactgcaaaatcgctggctccctccccatgagggtg
tcctggtttaaggatggcaaagaaatagcttcttctgacagatacagaatagcgtttgtg
gaaggcaccgcctctttggagataagcagaatagacatgaatgacgcagggaatttcacc
tgtcgagccacgaattccgtgggaagcaaggacagcagcggagccctgattgtgcaagaa
ccacccagttttgtaactaaacccgcatccaaggatgttctgcctggctcagcagtctgc
ctgaagagcaccttccaagggtctgttcctctcaccatcagatggtttaagggtgacaaa
gagctggtttccggtggaagctgctatattaccaaagaagctttagaaagttccctggaa
ctctattcagtaaaaacctccgattcaggcacatatacctgtaaagtcagcaacgtcgcc
ggaggcgtggaatgcagtgcaaacttgtttgtaaaagaacctgccacatttgttgaaaaa
ttagagccatcacagctcttaaagaaaggagatgccacccagctagtctgcaaagtcact
ggtacccctccgattaaaataacatggtttgtaaacgatagagaaattaaggacagcagc
agacacaaaatgtcttttgtggagtccactgcagttctaagacttacagatgtcgccgtc
gaagacagcggtgaatatatgtgtgaggctcaaaacgaggctggcagtgaccactgtggt
agcattttaatagtcaaagagtcgccttactttaccaaagaatttaagccagttgaagtg
ttgaaggagtatgatgtcatgttgctggccgaggtggcaggcacacctccctttgagatc
acttggttcaaagataacacaactctgaggagtggtagaaagtataaaacctttcttcag
gatcaaatggttagcctgcagatcctcaagtttgtagctgctgatgctggtgaataccag
tgtcgggcgagcaatgatgtgggcagcagcacctgcagtgccagggtgacgctcagagaa
ccaccaacctttgtaaagaagatcgagagcaccagctcccttcgaggaggcaccgctgcc
ttccaggccatgctgaaaggctccctgccaatcgcagtgacttggttaaaagacaacgat
gaaatcaccgaagacaataatataagaatgacctttgagaacaatgtggccagcctgtac
ctcagtggcatcgaagtcaagcatgatgggaaatatgtctgtcaggccaaaaatgatgca
ggcatacaaagatgttctgccttactctcagtaaaagaacctgcaacaatcaccgaggag
gctgtgtctatagatgtcacccaaggagacccagccactttgcaggttaaattttcaggg
actaaggagattacagccaaatggtttaaagacggccaagaactgaccctgggccaaaaa
tataaaatcagtgtcactgacacagtctctatactgaagattatttctacagaaaagaca
gatagcggagaatatacttttgaggttcaaaatgatgttgggagaagcagctgcaaggct
cgcattaatgtgttagatcttataatacctccctcattcactaaaaagctgaagaaaatg
gacagcattaaagggtcttttattgacttagaatgtatagtgtctgggtcacatcccata
agtatccaatggttcaaagatgaccaggaaatttcagctagtgaaaaatacaaattctct
tttcatgacaatactgccttcttggaaatcaggcatctggaaagtaccgatactgggacg
tacacttgttctgccaccaacaaggcaggacacaaccagtgcagcggccatctgactgtc
aaagaacccccttactttgtggaagaaccacagtcgcaagatgtcaatcccaacacaagg
gttcagttaaaggctcttgtgggtggcactgcgcccatgacaattaagtggtttaaagat
aacaaagagctgcactcgggagcagctcgctcagtctggaaggatgacacctccaccgtg
ctagagctcttttcagccaaagccgctcactctgggacctacatttgtcaactgagcaat
gatgttggcatagcaaccagtaaagccactctctttgtaaaagaacctcctcaattcatt
aagaagcccagcccagtattagcactgaggaatggacagtctacaacatttgaatgccaa
ataacaggcactcctgaaatcagagtttcttggtatctggatgggaatgaaataacagcc
attgagagacatggcatttccttcatcgatggtttggccactttccaaatttccggagcc
agggtagaaaatagtgggacctatgtctgtgaagctcgtaacgatgcaggcaccgcaagc
tgcagcatcgaattgaaagtgaaagagcctcccacctttatcagggagttgaggcccgtg
gaagtagtgaaagatagtgacgtggagctggagtgtgaagttatgggaacacctccgttt
gaagtcacttggctgaagaataataaggaaattcgaagcagcaaaaagtataccctgact
gacagagtgtcggtgtttaatctgcacataaccaagtgcgacccctcagacactggggaa
taccagtgcattgtgtccaatgaaggcggcagctgttctggcaatgctagagtctccctc
aaagaaccaccatcgttcacgaagaagatagaaaacatcactactgttttgaaaagttct
gccacttttcagagcaccgtggcaggctctcctcccatttccataacctggctgaaggat
gatcagatccttgacgaagatgataacattcatatttcctttgtgaataacgtggccaag
cttcagatcagagctgtggataacgggcacagcgggaggtacacgtgtcaagccaagaat
gagtcaggagttgagaggtgttatgctttccttttagtacaagagcctgctcaaatccta
gagaaggctaaatccgttgatgtcactgagaaagacccagtgaccttggagtgtgttgtg
gctggaacaccagaactcaaagtgaaatggcttaaagatgggaagcaaattgtgcccagt
agatattttacgatgagttttgaaaataatgtggccagttttaggattcagtcggtaatg
aagcaagacagtggtcagtatactttcaaggtggaaaatgactttggaagcagtagctgt
gatgcctacctgaatgtgctagatcaaaatatccctccatcgttcaccaaaaaattaacc
aaaatggataaagttctgggctcttctattcatatggagtgcaaggtttctggctcactt
cccattagtgctcagtggtttaaggatggaaaagaaatatctacaagtgcaaaacacaga
ctggtctgtcacgagaacaccgtggccctggaagtttacaacctggaattagaagacact
gcgaattacacatgcaaggtctcaaatgtcgcaggggatgatgcatgcagtggcatctta
actgtgaaagaaccaccaagcttcctagtgaaacctgggcgccaacaagccatacctgat
tctgcagtggaatttaaagcagttctaaaaggaacaccaccattcaaaataaagtggttt
aaggatgatgtggaacttgcccctggacctaaatgcttcattggcttagaagggtcaact
agcttcttaaatctctactcagtggatgcttccaagacaggacaatatacttgccaagtt
accaatgatgttggtagcgactcttgtactacaatgttgcttgtgacagaaccaccaaag
tttgtaaaaaaattagaaacatccaaaatagtgaaagcaggtgactcagcacgacttgaa
tgcaagatcactggatccccagaaatcagagttgtgtggtacagaaatgaacatgaactc
ccagccagtgataaatacagaaccacatatcttggctcttccaatttaaaaacaaagaaa
taaaaatattctatgaaattaaatagcccaattcataagaaactcttattttttacagaa
ccgcctgtctttagcagcttccctcctgtagtagaaacccttaaaaacactgaagttagt
cttgagtgtgaactctcaggaacaccaccatttgaggtggtgtggtacaaagacaagcgg
caactccgaagtagcaagaaatacaagattgcatccaaaaacttccatgcaagtattcac
attctcaatgtcgaaacttcagacattggtgaataccactgcaaagcacagaacgaagtg
ggaagcgacacttgcatttgcactgtaaaattaaaagaaccaccaagatttgtttccaag
ctgaacagcctcaccgttgtagctggggagcctgctgagctacaagcatctatagaaggc
gtccagcctatttctgtccagtggcttaaggagaaggaggaagtgattagagaaagtgaa
aacatcagaattacatttgtggaaaatgttgcaactctacagtttgcaaaagcagaacca
gctaatgctgggaagtatatctgccaaatcaagaatgatggtggaatgagggagaacatg
gccacattgactgttctagagcctgcagtcattgttgaaaaggcaggacccatgacagtg
actgtaggggaaacatgcactctggagtgtaaggtggctggcactcctgaactctcagtg
gaatggtacaaggatggaaagctgttgaccagcagccaaaaacacaaatttagcttctac
aacaaagtctcttctttaaagattctctccgttgaaaggcaagatgcaggcacatatact
ttccaggttcaaaataatgttggaaaaagcagctgcacagctgtggtcgatgtctcagac
cgaatggttcctccctctttcacacggagactgaaagatactggtggggtgctggggact
tcttgcatcttggaatgcaaagtagccggatcatcgcctatctctgttgcctggttccat
gagaaaactaagattgtcagtggagcgaagtaccaaaccacattttcagataatgtctgc
acattgcagctgaattctctggacatgtcagatatgggcaattacacatgtgtggctgct
aatgtcgctgggtctgacgaatgtcgtgcagtgttgactgtacaagaatcaccctctttt
gtgaaggaacctgaacctttggaagtactaccaggcaaaaatgtcaccttcacaagtgtt
atcagaggaacccctccattcaaggttggctggttcagaggtgccagagaactggtgaaa
ggagacaggtgcaacatctattttgaagacactgtagcggaactggaattatttaatgtc
gacctatctcagagtggggaatacacctgtgtggtttctaacggtgctggccaaacatcc
tgcaccactcgtctttttgttaaagaacctgctgcatttgtgaagaaattaagcgatcac
tctgtagaaccaggaaagtccatcattctggagggcacctacactggaacacttcccatt
tcagttacatggaaaaagggtggtgttcccataaccccatctgaaaaatgcagcgtagtc
acaacagagaagacttgcatcctggaaattctgaatagcacgaaaggagacgcaggagag
tattcctgcgagattgaaaatgaggcaggaagggatgtttgcaaagctctggtgtctacg
ttagaaccaccttattttgttacggaactggaacctctggaggcagccgttggagattcg
gtttctttacagtgccaagttgctgggacaccagaaattacagtgtcttggtacaaggga
gacaccaagttacggccaactcctgaatataggacctactttacaaacaatgtggccaca
cttgtttttaataaagtgaatctcaatgacagtggagagtacatatgtaaggcagaaaat
agcataggaactgcttcttctcagactgtcttcagaattcaagagcgtcaactcccacct
tcctttgcaaggcaattaaaggacattgaacaaactgttgggttaccagttacactcact
tgtcgattaaatggctctgcacccatccaagtgagctggtatagagatggggtacttttg
cgagacgatgacaatctacagacatcctttgtagataatgtggcaactttgaaaattttg
cagactgacttgagtcactctggccagtactcttgctcagcttccaatccacttggaaca
gcatcttctagtgctagactgatagcaagagaacctaagaaatctcccttctttgacatc
aagcctgtatctatagatgttattgctggggaaagtgctgactttgagtgtcatgttact
ggcgctcaaccaatgcgaatcacttggtcaaaagataacaaggagatccgtcctggagga
aattatacgatcacatgtgtgggaaacactccccatttgagaattcttaaagtaggcaaa
ggcgattccggtcagtatacttgccaagcaaccaatgatgttggcaaagacatgtgctca
gctcaactcagtgtaaaagaacctccaaagtttgttaagaaattagaagcttcaaaagtt
gcaaagcagggagaatccatccaactggaatgtaaaataagtggttccccagaaatcaaa
gttctgtggttccgaaatgacagtgagcttcacgaaagttggaaatacagcatgtccttc
gttaattccgtggcgctgctcaccatcaatgaggccagtgctgaggacagcggagactat
atctgtgaagctcacaacggtgtgggagacgccagctgcagcaccgcgctgaccgtgaaa
gcacctcctgttttcacccagaagcctgctccagtaggagcccttaaaggttctgatgtc
atcttacaatgtgaaatttcgggaacacccccatttgaagtgatatgggttaaagaccgg
aagcaagttcgaagcagcaagaaatttaaaattacttcaaaaaattttgacacaagtctc
catatccttaaccttgaggcctctgatgtaggagaatatcactgcaaagctactaacgag
gtgggaagtgacacgtgcgtctgcactgtcaagttcagagaacctccacgatttgtgaaa
aagctgagtgacacctcaacccttgttggggatgctgtcgagttacgggctgtagtggaa
ggcttccagcccatttctgttgtctggctgaaagatagaggtgaagtcatcagagagagt
gaaaacacgaggatttcattcgttgataacatcgcaaccctacaacttagtagcccagaa
gcatctcatgccggaaaatacgtgtgccaaatcaaaaatgatgctggaatgaaagaatgt
tccgccgtcttgactgtactagaaccagccagaatcgtagagaagccagaacccatgact
gtcactacaggaaatccttttgcactagagtgtgtagtggctggatcaccagaactttca
gccaagtggttcaaagatggaagagaattatctgcagacagcaaacatcacattacgttc
atcaacaaagtggcttcccttaagatcccctgtgcagaaatgagtgacagggggttgtac
agttttgaagtgaaaaacagtgttggtaaaagtaactgcactgtatctgttcacatttcc
gatcgagttgtgcctccttccttcatccgcaagctgaaagacacgaacgccaccctgggg
gcctcagtggttttggagtgccgagtctccggctcggccccaatctctgttggctggttt
caggatggaaatgagatcgtcagtgggcctaaatgccagcccagcttttcggaaaatgtc
tgtactttgaatctgagcttgctggagccttccgacgcaggcacatacacgtgtgtggct
gccaacgtggctggttctgaggagtgctcggcagtcctgactgtgcaagaaccaccatct
tttgaacaaaccccggattctgtggaagttttacctggaatgagtgtcacattcaccagt
gtcattagaggcacccctcctttcaaggtcaaatggtttaaaggcagcagggaactagta
tcaggggagtcctgcaccatctctctggaagagtctgtcacggaactggagttgtttgag
gtggagccattgcagagtggggactattcttgcctcgttactaatgatgctggcagtgct
tcctgtaccacacatctttttgtgaaagagccagccacctttgtgaaaagattggctgat
ttcagtgttgagacaggaagtcccatagttcttgaggccacatacaccggcacgcctccc
atctcggtgagctggatgaagaatgagtttcctcttgcacagtctccgaattgcagtgtt
actatgacagaaaaatctaccatactggaaattgtcgacagcacagtagaggattatgca
caatacagttgcctgatagaaaatgaggccggtcaagatatttgtgaagctctggtgtct
gtcttagaaccaccttattttattgaacctctggaacatgtcgaagcagccattggagaa
cctacaactttgcagtgtaaagtggacggaaccccagaaattagaatttcttggtataaa
gaacacacaaagctgcgatctgctcctgcgtacaaaatgcaattcaaaaataacgttgcc
tccttagtaatcaacaaggtggaccacagtgacgtgggagagtacacctgcaaggcagaa
aacagtgtgggggcagttgcttcttcagctgtgcttgttatcaaagaccgcaaacttcca
cctacttttgcaagaaaactgaaggacgtccatgagactcttggcttcccagttgccttt
gaatgtcgcatcaatggctcagaacctcttcaagtgtcctggtacaaagatggggtgctt
ttgaaagatgattctaatttgcaaacatcttttgttcataatgtagcaactctccagatt
ttacaaactgaccagagccacgttggtcagtacaattgctcagcttctaatcctcttggg
actgcttcatccagtgccaagctcattctctcagagcatgaagtgcctcctttctttgat
ctaaagcctgtgtcagtagatcttgctcttggagaaagtgggtcttttaaatgccatgtc
actggaactgcgccaatcaaaatcacttgggccaaagataaccgagagattcgccctgga
ggcaactacaagatgactttggttgaaaatactgccactctgacagttctcaaagtaggc
aaaggtgacgctgggcagtatacctgctacgcgagcaacgccgctggaaaagactcttgt
tctgctcttctgggtgtacaagaaccacccaggttcattaaaaagctagaaccttcaaga
atcgtgaagcaggatgaatccacaagatacgaatgtaaaataggagggtctccagaaatc
agagtttcgtggtacaaagatgaaactgaaattcaagagagcagtaaattcagaatgtca
ttcgttgactcagtggcagtgttggaaatgcaccatctcggtgttgaagacagcggcgac
tactcatgtgaggcccgcaatgcagcgggcagtgcaagcagcagcacttccttaaaagtt
aaagaaccacccattttccgcaaaaagcctcgtcccatggagacactgaaaggaactgat
gttcatcttgaatgtgagcttcagggtactcccccatttcaagtttcttggcataaagac
aagagagaacttaggagcggcaagaagtacaagataatgtctgagaacttccttacaagt
attcacatcctgaatgtggacactgcagacattggggaatatcagtgcaaagccacgaat
gatgtggggagtgacacttgtgttggttctatcactctgaaagcaccaccaagatttgtg
aaaaagctcagtgacatttctaccgtcgttggtgaagaagtccagctgcagaccactatt
gaaggcgctgagccaatttcagtggtgtggttcaaagataagggggaaattgttagagaa
agtgacaacatatggatttcttattcagaaaatactgcaaccctacatttttcaagagca
gaaatagccaatgctggaaagtacacctgtcagatcaaaaatgatgctggaacgcaagag
tgcttcgctacactgtccgttctcgaacctgcagcaattgtggaaaaaccagaatccata
aaagttaccacaggagacacctgtacgttggaatgcatagtcactggcacacctgaactc
agtactaagtggtttaaggatggaaaagaactgacaagtgacagcaaatacaaaataagc
ttcttcaacaaagtatctggtcttaagattatcaacgtatcccccagggacagtggggta
tacagctttgaagtgcaaaaccccgttggcaaagacagctgcacagtctcagttcaagtg
tcagaccgaactattcctccctcattcacaagaaaattgaaagaaacgaatggtctatct
ggttcttcagttgtaatggagtgcaaagtctatggatcgcctccaatctctgtctcatgg
ttccatgagggaaatgagatcagcagtgggaggaagtaccagaccaccctgacagataac
acgtgcgctttaactgtgaacatgctggaagaatcagatgctggtgactacacctgtgta
gctacgaatgtggctggttctgatgaatgcagtgctcctttgactgtgagagaaccgcca
tcttttgttcagaaacctgatgccatggatgttttgactggagccaatgtaactttcacg
agcatcataaagggaacacctcctttcagtgtcagctggttcaagggcagcagcgaacta
gtgccaggggacaggtgcaatgtgtctttggaagagtccgttgccgaactggagctgttt
gatgtggacacctcacaaagtggagaatacacctgcatcgtcactaacgaagccggcaaa
gcttcttgcacaacacgcctccacgtcaaagccccagctaaatttgtgaagaggctcaac
gattacagcatagagaaaggaaaagccctgatcctggaaggcacgtacacgggaactccc
gccatttcagttacatggaagaaaaatggcataaatattgctccgtctcagaggtgtaac
ataaccacaacggaaaaatcctcaatcctggaaatccccagcaccgcagtggaggactcg
ggccaatacaactgctacattgaaaatgcttcgggaaaagactcctgttcggcacaaata
cagatcctagaaccaccgtattttgtcaagcagttagagcctgtgaaggtgactgttgga
gattctgcctccttccaatgccaacttgctggaacccctgaaattgtggtgtcctggtac
aaaggagatacgaagctgaggcccactgccacctacaagatgcatttcaggaacaatgtt
gctacactggttttcaaccaggttggcagtcaggacagcggagaatatatctgcagagct
gaaaacagcgtgggagaagtctcttcctcaactttccttactgttcaagagcaaaaactt
ccaccgtcattttctcgacaattgagagatgttcaagaaacagttgggctgccggttgtt
tttgaatgtgccgtaactgggtcagagcctctctccgtgtcctggtataaggatggcaag
ccattgaaagatggcccaaatgtacaaacatcctttttagataaggtagccaccctcaac
atttttaaaacagaccggagcctcgcaggccagtattcctgcacagctacaaatcctata
gggtctgcctcttctagtgcccgactcattctcacagaggggaagaacccacccttcttt
gacatccacattgcccctgtggatgctgtggtgggagacagcgcggactttgagtgccac
gttactgggacacagccgataaaggtcagctgggccaaggacaaccgagagatacgaagt
ggtggcaactaccagattagttacctggaaaacactgcccacctgacaattctgaaagta
gacaagggagattctggacagtacacctgccatgctgtgaatgaggtgggaaaggactcc
tgcacagctcaacttaatataaaagagcggctaaccccaccaagtttcactagaaagctc
tcagagacagtagaagaaacagaagggaattctttcaaacttgagggccgtgtggccggt
tcccagcctatcactgcggcttggtacaagaataacgtagagatacatccaactcctaac
tgtgaaatcacattcaagaacaacatactgctgctgcacgtcaagaaggcgggcatgggc
gacgctggtttgtacacgtgcaaagtgtcaaatgatgcaggctctgctctgtgtacatct
tccgttgtcatcaaagagcctaagaagccacctgtgtttgatcagcacctgagtcccgtc
acagtgaatgaaggagaattcgtgcagctcagctgccacgtccagggttcagagccaatc
aggatccagtggctgaaggctggcaaggaaatcaagtcttcagacagatgcagcttcagc
tttgctagtgggactgctgtgctggaactcaaggatgtagccaaagcagatgcgggcgat
tatgtgtgtaaagcttccaatgcggctggcagtgacacttccaaatcaaaagtgaccatt
aaagacaaaccaaccgctgtccccacagctaagaaggcagcagtagacgggaaactcttc
ttcgtatcagaacctcagagtatcagagtggtggaaaaaaccactgcaacattcattgca
aaagttggcggcgatccaatccctaatgtgaaatggacaaaagggaaatggagacaactg
aacccaggaggccgtgtttccatcctgcagaaaggcgatgaggccaagctggagatcaga
gataccacaaaaaccgattctggcttgtaccgatgtgtcgcatttaataaacacggcgaa
attgaaagtaatgtcaacctgcaggtggacgaaaggaagaaacaagagaaaattgaagga
gatcttagagcaatgctgaaaaaggctcccaccttaaagaggggctctggggaagaagag
gaaattgatatcatggaacttctcaaaaatgttgatcctaaagaatatgaaaaatatgcc
cgcatgtacggcatcactgacttccgcggtcttcttcaagcatttgaactgctaaagcaa
agtcaagaagaagagacacatagattggaaattgaggaaatagagaagtcagagaaagaa
gaaaaggaatttgaagaacttgtatcatttattcaacaaaggctgtcacagacagagcct
gtcactctgatcaaggatattgaaaatcagacagttttgaaagataatgatgctgtcttt
gaaatcgacattaagattaattatccagaaatcaagctttcatggtacaaagggactgta
aaactggaacccagtgataaatttgaaattagcatcgatggtgatcgacatatacttaga
gtcaaaaactgtcaacttaaagatcagggaaattatagattggtgtgtggccctcacatt
gctagtgctaaactgacagtaattgagcctgcgtgggaacggcacctgcaggatgtcact
ctgaaggaaggccagacttgcaccatgacgtgccagttttctgtgccaaacgttaaatcc
gaatggttcagaaatggcagaatcctgaaaccccaaggtcgacataagacagaagtggaa
cacaaagtccataaactgaccattgcggatgtgcgcgcagaagaccagggccagtacacc
tgcaagcacggagacctggaaacttcagcagagctccggattgaagctgagccaattcag
tttacaaagcgcatccagaacatcgtggtgagcgagcatcagtccgccaccttcgagtgc
gaggtgtcctttgatgatgccattgtaacctggtacaaaggaccaacagaactgattgag
agccagaaatacaactttaggaatgacggtcgctgccactatatgaccatccacaacgtg
accccagatgacgaaggtgtctattcagtaattgctcgactggagccaagaggagaagcg
agaagcacagcagagctgtacctaacaaccaaagaaatcaaacttgagatgaagcctccc
gatattcctgactccagagttccaatccctaccatgcctatcagagcaataccgccagaa
gaaatccctcctacagctgttcctcctatccctgtgttgctaccatcacctgaagaaaag
aaaccaccagcaaaacgtattgaagtgaccaaaaaagctgtgaagaaagataccaaaaaa
gtcgcaaagcccaaagaagaggagccaccaccgaaagtcccagaggttaagaagcccccg
cctcctactgccttaattccagcaaaagctcctgaagttattgacgtatcctccaaggct
gaagaagtgaaaataacaaccatcaccagacagaaagaggttcgggagaaaaaagaagcc
gtgtatgagaaaaagcaagcagtctacgaggagaagaaagtttacatcgaacctttggaa
gaaccttatgacgagctggaggtggaaccgtacacagagccatttgaagaaccctattat
gaagagccagaggaagactacgaagagaccagggaagaagctaaaagggaggttcacgag
gaatgggaagaagactttgaggaagggcaagaatactatgaaagggaagaaggctatgac
gaaggggaggaagagtgggaggagacttacagagaaagagaagtaattcaagttcaaaag
gaggtttatgaagaatcacatgagagaaaaattccagaaaaagtgcctgaaaagaaaaaa
gcaccacctcctaaagtaccagctgtgcatacaaagaagatggttatttcagaagaaaag
atgttctttgcctctcacaccgaggaggaggtgtcagtaacagttcctgaggtacaaaag
aaaactgttaccgaagagaaaattcatgttgctgtttccaaaaagattgaacctccacca
aaagtccctgagccacctaagaaagctgccccagaagtggttcctgttcccactcctaaa
aaggtggagcccccaccggccaaagttcctgaagttcccaagaaacctgtgccagaggag
aaaaagcccgttcctgtacccaagaaggaacctgccgctcccccaaaagtcccaggagtg
cccaagaaacctgttcctgaagaaaagattcctgttcctgttgcaaaggaaaaggaagcc
cccccagccgaagttcctgaagtacagaagagggttgtcacagaagaaaaaataaccatt
gttactcagagagaggaatcgccaccaccagcagtgccagaaataccaaagaagaaagtt
cccgaaggaaaaagacctattcctcctcggaaagtggaagaagctccaccaccaaaagtg
ccagctctgcctaagaaacctgtcccagaggagaaagtttcggtaccagttcctgttgct
aagaaagctcctcctccccgagctgaagtttctaagaaaaccgtcctagaagaaaaaaga
tttgctgctgaagaaaagctatccgttgcagttcctcacaaagtggaagtcacgcggcac
gaagtatctgcagaggagaaatggagttattctgaacaagaggaaagagcgtccatttca
gtttatagagaagaagaaagagaggaggaggaggaggaagtggaggttacagaatatgaa
gtgctggaagaacctgaggagtatgttgtagaagaaaaactgcacattatctccaagaga
gtagaagctgaaccagccgaagtgcctgagaagcatgagaagaaaattgtaccaaaacca
aaaatccctgctaaaatagaggaacctctaccagcgaaagttcccgaagcacctaagaaa
actgtgctagaaaagaaaattccggccgcagttccgaaaaaggaaaaggtgccgccagct
aaagtgccagaagaaccaaagaaaccaattcctgaaaaaagggttcctcccaaagcggct
aaactagaagagcctccccccaccaaagtgactgagaggcacatgcaaattacccaggaa
gaaaaagttcatgttgctgtaactaaaagagaggagcctcctagagccagagtgcccgag
gaacccaagagagctgttccagaagaaaaggttctcaaactcaaacctaaaaaagaggag
gcgccaccggccacagtgactgaagtcaggaaaagagctgttaaagaagaaaagatatcc
attgaagtcccaaaaagagaacctcgtcccactaaagaagtaactgtaacagaagagaaa
gaatggtcttacacccgagaggaagaaactgtttcagtgcatcgggaagaggaatatgaa
gcatacgaagaatacgattataaagaatttgaggagtatgaaccagcagaagaatatgac
caatatgaagattatgaggaacgtgaacttgaacattatgaagagtctaaagaatatatc
acagaacctgagaagcctatcccagtaaagcctgtacaagaagaaccggttcccacaaaa
ccaaaggccccacccactaaagttgtgaagaaagctgtccctgaagaaaaagtaccagtg
cccattcctaagaaactcaaacctctaccacccaaagtgcctgaagaatcaaagaaagtt
gttgaggaaaaagtacgcatttcaattaccaaacgcgaaaaagagcaggtgactgaacca
gctgctaaagtgcccatgaagcccaagagggttgtcacagaagaaaaagtgcttattcct
aaaaaagaagtagcagcacctgttaaagtgccagaagcacctaaaagaccagaaccagaa
gagattacctttgaagaggaagttgtaacccaagtagaggaatatcttgaagaagaagaa
gaagaagaagaagagtatgttcatgaagaagagtaccttcatgaagaagaagagtacctt
catgaagaagaggaagtcataactgaagaagtggtaccagtagttccagtcaaagtgcct
gagatacctaagaaacctgttccggaagagaagaaacctgttcctgttcccaaaaagaag
gaagccccaccagcaaaagtgcctgagattcctaagaagccagaggagaaagttcctgtg
cccattcctaaaaaagagaaggctccaccagctaaagttcctgaagtacccaagaaacct
gtgccggaggagaaagtgcctgtaccagttcctaaaaaggtggaggctccacccgcagaa
gtgcccaagaagcctgtgcctgagaagaaggtgccagttcctgctcctaagaaagtagag
gctccacctgtgaaagtgccagaggtgcccaagaagctcattccagaagaaaagaaacca
acacctgttctgaaaaaagtagaggctccaccccccaaagtgccaaagaaacgggagcca
gctccagttcctgtagctctgcctcgggaagaggaagttccattcgaagaagaaattcct
cctgaggaggaagttttacctgaggaagaggaaattcttccagaagaagaggaagtccct
cctgaggaagaggaggaggaagttcctcctgaggaggaagaattcgtacctgaggacgaa
gttgtccctgaagaagaagaagctgttccagaaattaaacccaaggtgccagtacctgca
agagtgcctgaggttaagaagaaagtgccagagaagaaagtgatcattcctaagaaagag
gaggctccccctaccacagttcctgaggtacctaagaaagtagaagaaagacgaattgtt
ccccctaaagaagaggaagttccaccagtcgaagtgtatgaggaacctgaagaacctata
ccagaagaagagatcccagaagaaccacctagcatagaggaggttgaggaagtggtgcca
cctagagtgccgcaagtggttaagaaagcagtacctgaagcacctactcctgttcctaaa
aaagtggaggcaccaccagctaaagtgccaaagaaggttcctgaggaaaaagtacctgtt
cctgttcagaaaaaagaagcacctccagccaaagtgcccgaagtacaaaagaaagttcca
gaaaagaaaatcccagaaaagaaagtccttgtgcctaaaaaagaagctgttcccccagct
aaagggagaactgtccttgaagaaaaaatatcagttgccttccataaggaggaagtagta
agagaaagaacagaactagaagtagtggaagcacacgtggaagaagctcttgaagaagaa
gagttccatgaagttgaagaatattttgaagaagaagagttccatgaagtagaagaattt
atcaaagtagaaaaacagagatttgaagaagtacacaaagttgaagaaattcatagggtg
atagaatttttagaagctgaagaagtggaagtatatgaaaaacccaaagctccacccaaa
gggccggagatatccgagaaagtcatccctccaaaaaaaccacccactagagttgttcct
cgaaaagagccaccagctaaagtacctgaagcgaccaagaaaattgtggtagaagaaaaa
gtacatgttcctgaagagcccaaatttccaccagctaaagtgcctgaggctcccaaagaa
gttgtccctgaaaagaaagtacctttggcacctcctaaaaagccagacgtccctcctctt
aaagtgcccgaggctcccaaagaagttgtccctgaaaagaaagtgcctttggcgcctcct
aaaaagccagaagttccaccagccaaagcaccggaggtgccaaaggcagctgtcccagaa
aagaaggtgcccgaagttattcctcccaaaccggagagccctccccctgaagtgcctgag
gctcccaaagaagttgtccctgaaaagaaagtacctgtggcccctcctaagaagccagaa
atcccacctgtgaaagtgcccgaggctcccaaagaagttgtccctgaaaagaaagtacct
ttggcgcctcctaaaaagccagaagttccaccagccaaagcaccggaggtgccaaaggca
gctgtcccagaaaagaaggtgcctgaagttattcctcccaaaccggagagtcctcctcct
gaagtgcatgaagaacctgaagaaattgtctctgaagagcctcccgctgaacttgtggaa
gagccggagcccgtggctcctccaaaagtgactgcaccacctaagaaacctgtcccagaa
aagaaaccacctgctgtcgttgccaaaaaacctgagccaccacccatgaaagtgcccaaa
gtgcctaaggaagttgttcctgaaaagaaagagcctcccgtggttctcaagagaccagaa
atcccacctgtcaaagtgcctgaagttcccaaagaagttgttccagaaaagaaaatagtc
attcccaaaatgcccgaattcccaccagctaaagtgccagaagtgccaaagaaacctgtc
ttagaagagaaaccagctgttcctgttcccaagaaagtggagtctcctcctccagaagtg
tatgaagagcctgaggaaattgctcctgaagaggaagcaccagttcctgctgtggaagaa
gaggagccagaagccccaccaccggcagtgcctgaagagcccaagaagattgttccagag
aagaaagttcctatcatcaaaaaaccagaagctcctcctaaagaacctgaacctgaacct
gaaaagaaggtcattgagaaaccaaaattcaaaccaaagcccccagctcctccaccggct
ccacctaaggaagacgtgaaggagaaagtattccaacttaaagctgtttcgaagaaagtt
cctgaaaaacccgaggtcccagagaaggtggagcttaagcctgtgaaagtgcctggagtt
gaaaagaaagttcgcaaattacttcccgaacctaaacctcaaccaaaggaagaagttgtt
ctcaaaagcgttctgagaaagcgatctgaagaagaagaacctaaagtagaacctaaaaaa
gtagaaaaagttaaaaaacctacagtaccagaaccacctccaaaagctgttgaggttgaa
gcacccccaactactgttgcgaaagtggaaaagaaaattcctgaaccagcaaaagtgcct
gaaataaagccagcaatacctctccctggacttgaaccaaaaccaaagcctgaaccagaa
gtgaaaacagtcaaaccacctcccatggagcctgctccagcccccatcactgccccagtg
acagcaccagtcgtgggaaagaaagcagaagccaaacctaaagaggaggctgccaagccc
aaaactcccatcaaagtgggtgtagccaaaaagactccttcaccagtagaagctgaaagg
aaaaagttaagaccaggaagtggtggggagaaacctcctgatgaagccccattcacctac
cagctaaaggctgtaccactcaagtttgtaaaagaaatcaaagacatcgtcttgaccgaa
gcagagtccgttggctcttctgcagtctttgagtgtttagtctccccctccactgcaatt
acaacctggatgaaagatggtagcagcatccgggagagcccaaagcaccgattcaccgca
gatggtaaagacagaaagctgcatatcgctgatgttcaactttctgatgctggtgaatac
acctgtgttttacgtttgggaaataaagagaagacctccacggctaaactgattgtagaa
gaacttcctgtgcgttttgtgaaaacgcttgaagaggaagtcacagtggtcaaaacacag
ccattgtacttgagctgcgagttaaacaaagaacgcgacgtggtctggaggaaggatggg
aagattgtggtggagaaacctggcaaaattgtgccgggggtcattggcttgatgcgggcc
ctgaccatcaacgatgcagatgacttcgatgctgggacatacacagtgactgtggaaaat
gccaacaatctggagtgttcatcctgtgtgaaagtagtagaagtcattagagactggctg
gtgaaacccatccgagatcagcatgtgaaacccaaggggacagctgttttcacctgtcat
atagcaagggatacgccgaacatcaagtggttcaaaggctatgatgaaatcccctgggaa
ccaaatgacaagactgagatcgtgaaagagggaaactatgtgcatctcaaaattaagaat
gcgctgccagaagatattgatgagtatgcagtggaaattgaagggaaaagataccctgca
aagctgacacttggagatcgtgaagtggagctgcttaaaccaatagaggatgttaccatt
tatgagaaggaaagtgcaagctttgatgcggaaatctcagaagaagacgttcccggacaa
tggaaactgaagggagaacttctgaggccctcacctacctgtgaaatcaaagcagaaggt
gggaaacgcttcttaactttgcacaaagtcaagctggaccaagctggtgaagtcctttac
caagcacttaatgccgttacaactgccattctgaccgtgaaagaaattgagcttgacttt
gcggtgcccctgaaggatgtcactgttccagaaaagcgacaggctcggtttgaatgtgtc
ctgactcgagaggcaaatgtcatatggtctaagggacctgatataatcaagtcctctgac
aagtttgatatcattgttgatgggaagaaacacattcttgttatcaatgattctcaattt
gatgacgaaggagtctataccgctgaggtggagggcaagaagacctcggcacaattattc
gttacaggtgtaagactgcaattcatttcgcctcttgaagatcaaacagtgaaagaaggt
caaacagcaacttttgtctgtgaactttcccatgaaaaaatgcatgtcgtctggttcaaa
aacgatgccaaactccacacaagccgaactgtactcatctcatccgagggcaagactcac
aaattggaaataagagaagtgacattggatgatatatcccagatacgagttcaggttaag
gacctgaagtctacagcacacctaaaggtcttagaggccgatccctacttcactgtgaaa
ttacatgacaaaactggagtcgagaaggatgagattattctcaagtgtgaagtgagcaaa
gatgtgccagtcaaatggttcaaagatggcgaagagattgtaccttcacccaaacactcc
atcaagtcagatggcctgcgccgcatcttaaaaatcaaaaaggcagaatttagcgataaa
ggcgaatatgtgtgtgactgtggcacagacaagacgaacgcaaatgtcactgtggaggct
cgactaataaaagtggaaaaacctctttatggagtagaattgtttgttggtgaaacagct
cgctttgaaattgaactttcagagccagatgtccatggccagtggaagctgaaaggagag
cctttgactgcatcccctgactgtgaaatcatcgaggatgggaagaagcatattctggtt
ctttataactgccagctggatatgacaggagaggtgtccttccaggctgccaatgctaaa
tcggcagccaatctgaaagtgaaagaactgcccctgatcttcatcacccctctcagcgac
gtgaaagtctttgagaaagatgaggcgaagtttgaatgtgaggtatccagggagcccaaa
accttccgttggctgaaaggaacccaggaaatcacaggtgatgacagagtggagcttata
aaggatggtactaagcattcgatggtgatcaaatcggctgcttttgaagatgaagcaaaa
tacatatttgaagccgaagacaagcacaccagtgccaaactgatcattgaaggaatccgg
ctcaaattcctcactcccctcaaggatgtgacagccaaagagagggagaatgccgtgttt
actgtggagctgtctcatgacaacatccccgtgaagtggttcaagaatgaccagcgcctg
cataccagcaagcgggtctcaatgcacagtgaggggaaaactcattcaatcacattcaaa
aacctctctcttgatgatacctctcaaattaaagtagaagctatgggaataagttcagaa
gctaaactcacggtacttgagggagatccatactttacaggaaagcttcaagattatacc
gctgtagagaaagatgaagtgattctacagtgtgaaattagcaaagcagatgcaccagtc
aaatggtttaaggatggagaggaaataaagccatcgaaaaatgttgttattaaagcagat
ggcaagaagcgcatgctaatcctaaagaaagccttgaaatcagatatcgggcagtacacc
tgtgactgtgggacagataagacctcaggaaagcttgacattgaggatcgggaaataaaa
ctgctgcgccccctgtacagtgtggaggtgatggagacggagacagcccgctttgaaact
gaaatctctgaagatgacatccatgccaactggaaactcaagggagaggcactgctccaa
acacctgattgtgagatcaaggaagaaggcaaagtgcacttccttattttgcacaactgc
cgcctggaccagaccggcggggtggatttccaagctgccaacgttaaatctagtgcccac
ctccgagtaaaaccgcgagtcattggtcttctgaggcctctgaaggatgtcacggtgacc
gcaggggaaaccgccaccttcgactgcgagctctcttatgaggatatcccagtggaatgg
tatctcaaagggaagaaactggagcccagcgatacggtggtcacacgttcagaaggaaga
gttcatacacttactctgagggatgtaaagttagaagatgctggagaagtccaactaaca
gcaaaagatttcaaaactcaagccaatctcttcgtgaaagaacccccagttgaattcact
aagcctcttgaggaccagacggtcgaagaggaagccactgcagtattggagtgtgaagta
tccagagagaatgctaaggtgaaatggttcaaaaatggcacagaaattctcaaaagcaag
aagtacgaaattgttgctgatggcagggtcagaaaacttattatacatggctgtaccccc
gaggatattaaaacatacacttgtgatgctaaggattttaagacttcctgtaacctgaat
gtcgtgcattatgcttgttgcactaaacaagatgctgtttctttgctaccggtgtttcct
ttgacaatatcaactttcaactctggagagtatcagtgggaatttttcttccagttatta
ttcaagagaactgacctggtccagtggtttaaagatggtgctgaaattaagaagggcaaa
aaatatgacatcatatctaaaggagcagtgcgcatccttgtcatcaacaaatgtctcctg
gatgatgaagcagaatattcctgtgaagtaagggcagcacgaacttctggcatgctgaca
gtactggaagaagaagctgtctttacaaaaaatcttgccaatattgaagttagtgaaaca
gacactataaaactggtctgtgaagtctccaagcctggagcggaagtgatttggtacaaa
ggggatgaagagatcattgaaacaggaagatatgaaatactcactgacggacgaaagaga
attctggtcattcagaatgcccaacttgaggatacaggcagctataactgccgactccca
agttctcgaactgatggcaaagtcaaagtacatgaacttgctgctgaatttatctcaaag
cctcaaaaccttgaaatacttgaaggagaaaaggctgaatttgtctgtactatatcaaag
gaaagctttgaagtccaatggaagagagatgataagacacttgaatctggcgataaatac
gacattattgctgatggcaagaagagggtcctagttgtgaaagatgccacattacaagat
atgggcacttatgtcgtcatggttggggctgccagagcagcagctcacttgacagtaatt
gaaaaactcaagatcatagttcctcttaaggacacccgcgtgaaagaacaacaagaagtc
gtcttcaactgcgaagtcaatacggaaggtgcgaaagccaaatggttcagaaatgaggaa
gccatatttgatagttcaaaatacatcattctccaaaaagacctggtctacaccctcaga
atcagagatgcgcgattagatgatcaagccagctataatgtgtctctgaccaatcataga
ggtgaaaatgttaagagtgcagccaatctgatagtggaagaggaagaccttaggattgtt
gagcctcttagagatattgaaacaatggaaaagaaatctgtcacattctggtgcaaggtg
aatcgtctcaatgtaacactgaaatggaccaaaaatggagaagaagtggcttttgacaac
cgcattttatacagaattgataaatataagcactctctcattattaaagactgtggcttc
ccagatgagggtgaatacattgtcactgctggacaagataaatctgtcgctgagcttctc
atcatagaagctcctacagaattcgtggaaaacttggaagaccagacagtcaccgagttt
gatgatgctgtcttctcctgccagctgtccagagagaaagcaaatgtaaaatggtacaga
aatgggagagaaatcaaagaaggcaaaaaatacaaatttgaaaaagatgggagcatacat
agacttattatcaaagattgcagactggatgacgaatgtgaatatgcctgtggagtagaa
gacaggaagtcacgagctaggctctttgtggaagaaatccctgttgagatcatcaggcct
ccccaagatatcctcgaagcccctggggctgatgtcatctttttggctgagctcaacaaa
gataaggtggaggttcagtggctaagaaataacatgattattgtccagggtgacaagcac
cagatgatgagtgagggaaagatacacaggctacagatttgtgatattaagccccgtgac
cagggcgaatacagatttatcgccaaagacaaagaagccagagctaagcttgaactggca
gcggcacctaaaatcaagacagctgatcaagaccttgtggttgatgtcggccagcctctg
acaatggtggtgccctatgatgcctaccccaaagcagaagctgagtggtttaaagacaat
gaagctctgtcatcaaaaacggtcgatactacagctgaacaaacttccttcagaatttta
gaagccaagaaaggagacaaagggagatataaaattgtgcttcagaacaaacatggaaaa
gcagaagcattcatcaatttagaagtgattgatgttcctggaccagtgcgtaacttagaa
gtgacagaaacatttgatggtgaagtgggcctcgcttgggaagaaccattaactgatggt
ggaagcaaaatcataggttatgttgttgaaagacgtgacatcaagagaaagacctgggtt
ctggccactgaccgggcagacagttgtgagtttactgtcactggactacaaaaaggagga
gtcgagtatctattccgtgtgagtgcaagaaacagagttggcactggtgaaccagtagag
actgacaatccggtagaagcaaggagcaaatatgatgttccaggccctcctctgaatgtg
accatcactgatgtgaatagatttggtgtctcattgacatgggaaccaccagagtatgat
ggaggtgctgagatcacaaactatgtcattgaactaagggacaagacttctatcaggtgg
gacactgccatgacagtaagagctgaagacctatctgcaacagtcactgatgtggtggaa
ggacaggagtatagtttccgggtcagagcccaaaaccgaattggagttgggaaaccaagt
gcagccacacccttcgtcaaagttgctgatccaattgagagaccaagtcctcctgtgaac
ctaaattcctcagatcagactcagtcatcagttcagctcacatgggaacctcctctgaaa
gatggaggaagcccaatcctgggctacataatagaacgatgtgaagaagggaaagataaa
tggatccgttgcaatatgaaactggtccctgaactgacctacaaggttatggactttgtg
actgacttagaattcacagttcctgatcttgttcaaggaaaagaatatttatttaaagtc
tgtgctcggaacaagtgtggccctggagaacctgcatatgttgacgaacctgtaaatatg
tcagctcctgcgacggtacctgatccaccagagaatgttaaatggagagatcgaacagcc
aagagcatcttcctaacatgggatccacctaaatatgatggtggttcacgtatcaaagga
tatttagttgaaaaatgtccacgtggttctgatcgatgggtcgcctgtggagagccggtt
gcagaaacaaaaatgcaggtaacaggtcttgaagaaggccaatggtactcctaccgcgtg
aaggccttgaacaggctaggtgctagcaaaccaagcaaacccacagatgaaatccaggct
gtggacactcaggaggctccagaaattttccttgacgtgaagctccttgccggtctcact
gtgaaagcaggaactaagattgaacttcctgccactgtcaccgggaaacctgaacctaaa
atcacttggacgaaggccgataagcttctgaagcaggacaatagaatcaccattgaaaat
gttcctaacaaatccacagtgaccatcgccgatagtaagagaagtgatactggcacatac
atcattgaggctgtgaacgcctgtggtcgggccaccgctgtggtagaagtgaatgtccta
gataaacccggaccaccagctgcttttgacatcacagaagtgaccaacgagtcatgtctt
ctaacatggaaccccccacgagatgatggtggatctaaagtcacaaactatgttgtggag
agaaaagcaacagacagtgatatgtggcacaagctctcatcaactgtcaaggatacgaat
ttcaaggcaaccaaattaacacccaataaagaatacctcttcagagttgctgcagaaaac
atgtacggtgttggcgagccagttcaggctactcctataacagccaaatttcagtttgat
ccacctggacctccaactcgcctggaaccttctgatatcactaaagatgcagtgaccctc
acatggtgtgagccagacgatgacggcggcagcccaatcactgggtactgggttgaaaga
ttagatcctgataccgataaatgggttaaatgcaataagatgccaataaaggacacaaca
tacagagtgaaaggtctcaccaataagaaaaaatacagattccgtgtgctggctgaaaat
cttgctgggcctggaaaaccaagtagatcaactgaaccaatcttaataaaggatcccata
gatcctccatggccccctggaaaaccaaccgtgaaagatgtaggcaaaacatcattggta
ttgagttggacaaagccagaacacgatggaggggcaaagattgagtcttatgtcattgaa
atgctgaagactggaacagatgactgggtccgagtggctgaaggagttcccaccactcag
catttgctcccagggctcatggaagggcaggaatactcattccgagttagagctgtgaac
aaggctggggaaagtgaacccagtgaacccagcgaccctgtgctttgtcgggagaagcta
tatcctccatcaccacctcgctggcttgaagttattaatatcaccaaaaatacagcagac
ctgaagtggacagtccctgagaaagatggaggatcccccatcaccaactacattgtggaa
aagagagacgtgaggcgaaaaggctggcaaacagtagacaccactgtcaaggacaccaag
tgcacagtaaccccactgacagagggcgctttatatgtgttccgagttgctgcagaaaat
gccataggacagagtgactattgtgaaattgaggactctgtcctggccaaagacaccttc
accacccctggaccaccctatgctctcacagttgtggatgtgactaaacgacatgtcgac
ctaaagtgggaaccacctaaaaatgatggtggaagaccaatacagagatacatcattgag
aagaaagaaaagttaggtacccgttgggtaaaagctggaaggactacaggaccggactgt
aatttcagagtaactgatgtcattgaaggcacagaagtccagtttcaggttcgggcagaa
aatgaagctggagttggtcacccaagtgaacccacagaaattctgtcaattgaagatcca
acaagtcctccttcacctccccttgacctgcatgtaactgatgctggaagaaaacacatt
gacattgcttggaagcctccagagaaaaatggtggaagtcctattataggataccatgtt
gaaatgtgtccagtaggcactgagaaatggatgcgagttaattctcgccccataaaagac
ttaaaattcaaggttgaagaaggtattgttcctgataaggagtacgttctgagagtgaga
gctgtcaatgctgttggtgtcagtgagccatctgaaatctccgaaaatgtggttgccaaa
gacccagactgccagccaacaattgatctggagacccatgacattgttgttattgaaggt
gaaaaattaagcattcctgttcccttcagagctgtcccagttccaaccgttagttggcat
aaagatggcaaagaagttaaagcaagtgatagactaacaatgaagagcgatcacttctca
gcaaaccttgaagttcccaagagtgtccatgcagatgcaggagtttacactattacactg
gaaaataagcttggctcagcaactgcctcgatcaatgtcaaagtcataggcctacctgga
ccatgcaaagatattaaagcaagtgatgtgaccaagagttcttgtaaattaacctgggaa
ccaccagaatatgatggtggaagcccaattctacattatgtcctggaacgcagagaagct
ggaaggaggacatatataccagtcatgtctggtgagaataaactatcttggtctgtaaaa
gacctcataccgaatggtgaatacttcttccgtgttaaagctgtcaacaagataggtgga
ggcgaatatattgaactaaaaaatccagtcattgctcaagatccaaagcagccccctgat
ccacctatagatgttgaggttcataatccttcagctgaggcaatgactattacatggaag
ccacctttgtacgatggagggagcaagataatgggttacatcatagagaagattgctaag
ggtgaagaaaggtggaagagatgcaatgaacacctggtaccagtcctgacctatacagca
aaaggacttgaagagggaaaggaataccagttccgtgtgcgagcagaaaatgctgctggt
attggtgaaccttctcgggccactcctccaaccaaagctgtagatcctattgatgcccca
aaagtcattatgagaacaagtctagaagtaagacgaggtgatgaaatagcacttgatgca
acaatttctgggtcaccttacccaactattacatggctaaaggatgaaaatgtgcttaca
ccagaagaaatgaaaaaacgagtagcacccacagttaggagaaagaagggtgaagttcaa
gaagaagaaccatttgtcctgccactggtggagcgcttgagtattgacagtagtaaaaaa
ggagaatctcagctacgtgtccgagattctcttcgaccggaccatggccagtatatgatc
aaagctgaaaatgaccatggtgttgcaaaagctccttgtactgtcactgtgctggataca
ccaggaccaccgatcaactttgtatttgaagatattagaaagaactcagtcctctgcaaa
tgggaaccaccccttgatgatggtggcagtgaaattataaactacaccttggaaaagaaa
gataagacaaaacctgactcagaatggattattatcacttcaacactcagacattgcaaa
tattcagtgacaaaattgattgaaggaaaagagtacctcttccgtgtaagagctgaaaat
aggtttggccctggaccaccttgtgtttcaaagccacttacagctaaagatccatttgaa
ccacctgatgctcctgataagcccattgtggaagatgttaccagcaacagtatgctagtg
aaatggaatgaaccaaaggacaatggaagccccatcttgggttactggcttgaaaaacgt
gaggttaatagtacacattggtctcgtgtcaacagaaaccttctgaatgctttgaagacc
aatgtagaaggcctattagaaggactcacctatgtcttcagagtatgtgccgaaaatgcc
gctggacctggaaagttcagtcccccttcagatcccaaaacagcgcatgatccaatctct
ccacctggaccacctgtcccaagagtcgctgacacaagctccacaactattgaactagaa
tgggaacccccagctttcaatggcggtggggaaattattggctactttgtcgataagcaa
ctggttgggacaaatgaatggtcacgctgcacagagaagatgatcaaggtccgtaagtac
actgtcaaagaaatccgagagggtgctgattacaaactccgagtgagtgctgtcaatgct
gcgggtgaaggaccacctggagaaacgggacctgttactgtggctgaacctcaagagcct
ccatctgtggaactagatgtttctgttaagggtggaatacaaataatggctgggaagact
ctcagaattccagctgtggtaactggccgtccagagcctaccaaagtgtggaccatagaa
gaaggagaactggataaagaccgtgttgtaatagagaacgttggaaccaaatctgaacta
attatcaaggaagcattgagaaaagatcatggcagatatgtgatcacagctaccaatagc
tgtggttccaaatttgcagcagtcagggtagaggtttttgatgtccctggccccgttctt
gacttaaaacctgttgtaacaaacagaaagatgtgtctgctgaactggtctgatccagca
gatgatggaggaagtgaaatcacaggctttattattgaaagaaaagatgccaagatgcat
acttggagacaacccatagagactgagagatctaagtgtgatatcacaggtcttcttgag
ggacaagaatataagttccgtgtgattgccaagaacaagtttggctgtggcccgcctgtt
gaaataggaccaattcttgcagttgatccactaggtcctccaacgtctcctgagaggctc
acatatacagaaagaacgaagtccactatcaccctcgactggaaagagccccgcagtgat
ggtggcagccccatccaaggctatatcatcgaaaaacggcgtcacgacaaacctgacttt
gaaagagttaacaagcgactctgcccaaccacatcttttctggttgaaaaccttgatgaa
caccaaatgtatgagttccgtgtcaaagctgtcaatgcagttggtgaaagtgaaccatcc
ctgcctcttaacgtggtcatacaagacgatgaagtgccaccaactattaaattgcgcctg
tctgttcgaggagacactatcaaggttatggcaggagagcctgttaacattcctgcggat
gtgacaggccttccaatgcctaagattgagtggtccaagaatgaaactgtgattgaaaaa
cccactgatgcactgaagataaccaaggaagaagtatcccggagtgaggcaaagactgag
gttatcattcccaaagcagtccggcaggacaaaggcacttacacaattacagcttccaat
cgccttggctcagtcttccgaaatgtccatgttgaagtatatgatcgtccatctccacca
agaaaccttgctgttacagacattaaagctgaatcttgctatttgacatgggatgcccct
ctagacaatggtggcagtgaaatcacccattatatcattgacaaacgtgatgcaagtagg
aagaaatctgaatgggaggaagtcaccaacactgccgtagagaagagatatgggctctgg
aaacttatccccaatggccagtatgagttccgagttagggcagtgaataaatacggaatc
agtgatgagtgcaaatcagataaagtgaccattcaagatccctatcgccttcctggagct
ccaggaaaaccaaaagttttggagcgcaccaaagggtcgatgctagtgagctggactcct
cctttggacaatggcggctctccaattactggctactggctggagaagagagaagaggga
agtgcctactggtcacgtgttagccgagcaccaataaccaaagtgggatcaaaaggcgtg
gaatttaatgttcctcgtttgattgaaggtgttaaataccagttcagagcaatggcaata
aacgctgcaggaattggccctcccagtgaaccatcagatccagaggttgcaggagatccc
atatatccacctgggccaccttcttgcccggaggtaaaagataaaacaaagtccagcatc
tcgctggcatggaaacctccagccaaagatggtggcagtcccatcaaaggatacatcgta
gaaatgcaagaagaaggaaccactgactggaaaagagtaaatgagcccgataaacttcta
actgcctgtgaatgtgtggtgccgaatttgaaagaactcagaaagtacaggttcagagtg
aaagctgtcaatgaagctggcgaatccgaaccaagtgatacaactggagagatccctgca
actgatattcaagaggcaccagaagttttcattgacattggagcacaggacagtctgact
tgtcaagctggcacacagattaggattcctgnnnnnnnnnnnnnnngcgcccaaccaaaa
tcctcttgggaatttgatggaaaggcaaagaaggcaatgaaggatggagttcacgatata
cccgaagatgcacaggtggagactgctgaaaactcatcagtcattattattccggagtgt
aaacgatctcattcaggcaaatacagcatcacggccaagaataaagcaggacaaaagact
gcaagttgcagagttaaagtcatggatgtaccagggccacccaaagatctgaaagtcagt
gacatcacaaggggtagttgccgactgacgtggaagatgccagatgatgatggaggagac
agggtcagaggctatgtcatcgagaagaagactattgatgggaaagcgtggactaaagtc
aatccaaattgtggcagcaccacattcttggttcctgatctcatctctgaacagcagtat
ttcttccgcgtacgtgcagaaaaccgttttggcattggcccacctgtggaaaccattcag
aggaccactgccagggacccaatatatcctcctgaccctcctattaaactcaagattggc
ctcataacaaagagcacggtacacctgtcgtggaaacccccaaagaatgatggaggctcc
cctgtcacccactatattgttgagtgccttgcgtgggaccctactgggaaaaagaaagaa
gcgtggaaacagtgcaatcggcgtgatgtggaagaactggagtttaccgcggaagacctg
gtagagggtggggaatacgaattcagagtcaaagctgtcaatgaggcgggagtcagcaaa
ccctccgccactgtgggccctgtgattatcaaagaccagacatatgtgccaggtcctgtt
ggaaccccattcctgcctgacaacctgaccaatgactcctgcaaactgacgtggttttct
ccggaagacgatggaggctctccaatcaccaattatgtcattcagaaacgggaagctgac
cgcagagcatggaccccggtgacatacacagtcacccgacataatgctactgtccagggt
ctcattcaagggaaagcctactttttccgaattgcagctgaaaatagcattggcataggc
ccttttgttgaaacgccacatgaaattgtcatcagagatccaataagggttccttatgca
cctgaccagccaattgttacggaagttaccaaagactctgcattagtaacctggaacaag
ccaaatgatggaggaaagcccataacaaactacatcctggaaaagagggaaactatgtct
aaacgatgggctagagttaccaaagagccgatccatccatacactaaattcagggttcct
gatcttctagaagggtgtcagtatgaattccgggttgctgcagaaaatgaaattggtatt
ggagacccaagcccaccatccaaaccagtctttgccaaagatccaattgctaaaccaagt
ccacctgttaatcctgaagcaatagatacaacatgtaattcagttgacctaacttggcag
ccaccacgtcgcgatggtgggagcaagattctgggttacatcgttgagtaccaaaaagtt
ggagatgaagagtggagaagagccaatcacactcctgagtcatgtcctgaaactacatat
aaagtcactggtcttcgggatggtcaaacctacaagttcagagtactagcagtcaatgaa
gctggtgaatcagatccagctcatgttcctgagcctgtactagtaaaagatagacttgaa
ccccctgagttgattcttgatgccaacatggcgagagaacaacatataaaggttggtgat
actctaagacttagtgccatcatcaaaggagtgccattcccaaaagtaacttggaaaaaa
gaagacagagaggctccaactaaagcaagaattgatgttactccagttggtagcaagctt
gaaattcgtaacgctgcccatgaggatggtggaatttattccttaacagtggagaatcca
gctggttcaaaaactgtctccgtaaaagtgcttgtattagataagcctgggccacctcga
gatctggaagtcagtgaaattaggaaagattcttgctaccttacttggaaggaaccactg
gatgatggtggttctgttgttacaaattatgtggttgagaggagagatgttgcaggcgcc
cagtggtcacctctctcaactacgtccaagaaaaagagtcactgggctaaacatcttaac
gaaggcaatcagtatctcttccgagtggctgctgagaaccagtatggacgtggtcctttt
gttgaaacacctaaacccatcaaggctgtggatcctctgcatccccccgggccacccaag
gacctacaccatgtagatgttgacaagactgaagtctcccttgtttggaataagccagat
cgtgatggtggttctccaatcactggctatttggtggaatatcaagaggaaggaaccaaa
gactggattaagtttaagactgtgccagatttagagtgtgttgttactggactacaacaa
ggaaagatctacaaattccgtgtaaaagctgaaaatatcgtgggtcttagtctccctgac
acaactattccaatagaatgtcaggaaaaattagtgcctccatctgtggagctggatgtg
aaattaattgaaggccttgtggtaaaagctggaacgacagtcagattcccagccattata
agaggtgtaccctttcctactgcaaagtggacaagtgatgggagtgagattaaaaccgat
gaacattacacagttgaaactgacaatttctcatctgtactcaccattaagaactgctta
aggagagacactggggaatatcaaatcacagtttccaatgcagctggcaccaaaacagta
gctgtacatcttactgtccttgatgttcctggtccaccaacaggtcctattgatattctg
gatattagccctgagcatatgactatctcctggaagccacccagggatgatggaggaagc
cctgtgataaattatatcgttgagaaaaaagatacaagaaaagatacgtggggtgttgtc
tcttcaggaagcagtaagacaaagctgaaagtcccacatctgcaaaagggctctgaatat
gttttccgagttagtgcagagaataagatgggtgttggtcctccccttgactccacacct
actgttgctaaacataagtttaatcctccatcgcctccaggtaaaccagtggttactgac
attactgaaaattctgcaatgttgtcctggactctgccaaaatctgatggtggcagccca
ataactggttactatgtagaacgtcgagaaataactggcaaatgggtgagggtcaacaaa
acacctatagcggacttgaagtttagagtgacaggactctatgagggaaatacatatgag
tttagagtttttgctgaaaatcttgcaggacttagcaatccatccccaagttctgaccca
ataaaagcttgccggcccatcaaaccacctggaccacctattaatcctaaactgaaagac
aagaccaaagaaacagctgacttggtatggacaaagcctctcagtgatggtggtagcccc
attctaggctatgtagtagaatgtcagaaggctggtacgacacagtggaacaggattaat
aaagatgaactcattaggcaatgtgcctttacagtaccaggactaattgaaggaactgag
tacagattccgtataaaggcagctaatattgtaggagagggagagccaagagaactggca
gaatctgtgattgcaaaagacatccttcatcctccagaagtagaacttgatgttacttgt
cgtgatgttattaccgttagagtgggccaaactatccatattcttgctcgagtcaaaggc
agacctgaaccagacataacttggtccaaggaaggcaaagtactggtccgtgaaaagcgg
gttgacatcattcaagatctacctcgtgttgaattacaaattaaagaagctgttagagct
gatcacggcaaatatatcatctccgctaagaacagcagtggacatgcccaaggttccgct
attgttaatgtccttgacagacccggaccttgccagaatttaagggttagccatgtaaac
aaagagaactgtacagtttcttgggaaaacccactagataatggtggctcggagataacc
aatttcatagtggaatctcgcaaaccaaaccagaaaggctggtcaatcgttgcttcggat
gtcactaagcgattaatcaaggcgaaccttttagccaacaatgaatactacttccgagtt
tgcgcagagaataaagtaggtgttgggccaaccattgaaacaaaaactccaattctggct
attaaccctattgatagaccaggtgagcctgaaaaccttcacattgcagataaaggaaag
acatttgtctatctaaagtggcggcggcctgattatgatggtggcagcccaaatctatca
tatcatgttgagaggagactgaagggttctgctgactgggaaagaggacataaaggaagc
attaaagaaacccacttcatggtggacaaatgtgttgaaaaccagatttatgagttcaga
gtacaaacaaaaaatgaaggtggagaaagtgactgggtaaagacagaggaagttgttgtg
aaggaagatttacagaaaccagtacttgatctgaagttaagcggtgtattaactgttaaa
gcaggggataccattagacttgaggcaggtgttagaggcaaaccatttccagaagtttca
tggaccaaggacaaagatgctacagacttaacaagatcaccaagggtcaagattgatacc
agtgctgattcatctaaattttctcttactaaagcaaagcgaagtgatggtggtaaatat
gtaattacagcaactaacacagctggcagttttgtggcctacgccactgtcaatgtttta
gataagcctggtcctgtaagaaatctgaaaatttctgatgtgtccagtgataggtgtact
attcgctgggatccaccagaggatgatggtggctgtgaaatccaaaattatattctagaa
aaatgtgagagcaaacgcatggtttggtctacctattctgctgctgtcttaacacccagt
gctacagtaacacgtctcatagaaggaaatgaatatattttcagagtccgtgcagaaaat
aaaataggcacagggcctccaacagaaagtaaaccagtcattgcaaaaaccaaatttgat
agacctggtcgccctgatcccccagatgtcactaaagtaagcaaagaagaaatgactgtg
gtttggagtccacctgaatatgatggtggaaagtccatcacaggatactttttggagaaa
aaggaaaaacattcaatacgttgggtccctgttaacaagagtgcaatccctgagagacgt
ttgaaagtacagaatctcttcccaggacatgaatatcagttccgtgtcaaggcagaaaat
gaaattggaattggagaaccatctttgccatcaaaaccagtggtggcaaaagaccccata
gaaccacctggtccaccaaccaatctcaaagttgttgatacaaccaaaaattccataact
cttggatggggaaaaccagtgtatgatggtggtgcaccaataattggctatgttgtggaa
atgagaccaaagaaagaagatgcatcacccgatgaaggatggaaaaggtgcaatgctgca
gctcaacttattcgcatggaattcactgctaccagtttagacgaaaaccaggaatatgag
ttcagggtgtgtgcccaaaaccaggttggcattgggcgccctgcagaactaaaggatgcc
attaaacctaaagaaatcttagaatctccggagattgatttggatgccagcatgaggaaa
ctggtcacagtgagagcaggatgcccgattcgcctgtttgccatagtgagagggcgacca
gcccctaaagtcacttggagaagagtgggtattgataacgtggtcagaaaaggacaagtt
gatcttgtcgatacgatggccttccttgtcatccccaattctactcgtgatgactcagga
aaatattccttgacagttgtgaactcagcaggagaaaaggccgtgttcgtgaacgtcaga
gtattagatactcccggacctgtgtctgatttgaaagtttcggatgtcaccaaaacatca
tgtcacatttcctgggcccctcctgagaatgatggtgggagccaggtgacacattatatt
gtggagaaacgtgatgcagagagaaagacgtggtcaacagttacccctgaagttaagaaa
ctgagcttccaagttaccaatcttgtccctggaagtgaatatttcttcagagtaactgct
gtcaatgagtatggccccggcgttcctacagatgtccccaaaccagtgcttgcatcagat
cccctaagtgagccagatccaccaaagaaactggaagttactgaaatgaccaagaacagc
gctacgttagcttggttacctcccctgcgggacggaggagctaaaatcgatggctatatc
ataagttacagagaagaagagcagcctgcagatcgctggacagaatactcagtggttaaa
gatctcagccttgtcgtcactggcctcaaggaaggaaagaagtacaaatttagagtagtg
gccagaaattctgttggagtcagtttgccgagagaagcagaaggcgtgtatgaagccaaa
gaacagctgttgccaccaaagatccttatgccagagcaaattacaatcaaagcggggaag
aaacttcgaattgaagcccatgtgtatggaaagcctcatccaacctgtaaatggaaaaaa
ggagaagatgatgtcgtcacatccagccacctggttgtgcataaaacagatacttcttct
attctgatcataaaagacgttactaggaaagacagtggttattatagcctcactgcagag
aacagctctgggacagacactcagaaaatcaaagttattgtcatggatgctcctgggccc
cctcagcctccatttgacatttctgacatagacgccgatgcttgctccctgtcatggcat
atcccgctggaggatggaggcagtaacatcaccaattacgtagtggagaagtgtgatgta
agccgaggtgattgggtgacagcgctagcttcagtgacaaaaacttcctgcagaattgga
aaattgatcccagggcaggagtatgtcttccgggtccgtgctgaaaatcgatttggcatt
tcagagcctctcacatctccaaagatgttggctaagttcccatttgatgttcctagtgaa
ccgaagaatgcacgagtcacgaaagtcaacaaagactgcatatttgtggcctgggacagg
ccagacagtgatggaggaagccccatcactggttacctgattgaacgcaaagaaagaaat
agtttgctgtgggtgaaagctaatgatactcctgtccggtcaactgaatacccctgtgtt
ggccttatagaaggtcttgagtattcattcagaatctatgccctgaacaaagctggatcc
agcccacccagcaaaccaacagaatatgtgactgcaagaatgccagttgatcctccagga
aagcctgaagttatcgatgtttccaagagtactgtatccctcatctgggctcgtccaaaa
catgacggaggcagcaaaatcattggctatttcgtagaagcttgcaaacttcctggtgat
aagtgggtacggtgcaacactacaccacaccagattccccaggaagagtacacagctact
ggcttagaagagaatgctcagtatcaattcagagcaatcgccaagacagcagtaaacatc
agccagccttcggaaccttctgacccagtgaccatcctcgcagaaaatgttcctcccagg
atagaactgggtgtggctatgaaatctttgcttactgtcaaagctggaactaatgtctgc
ctggatgctactgtttttggaaaaccaacaccaacagtgtcttggaagaaggatgacaca
ctgctaaaaccagcagaaggcatcaaaatggcccggaagcggaacctgtgcaccttggag
ctgttcagcgtgaaccggaaggactcaggagactataccattactgccgaaaatccaagc
ggttccaaatcagccaccattaagcttaaagtgttagataaaccaggtcctccagcatct
gttaaaatcaataaaatgtattcagaccgtgcaatgctttcttgggaacctcctcttgaa
gatggaggctcagaaatcaccaactatattgttgacaaacgtgaaacaagcagacccaac
tgggcccaggtctctgcgactgtgcccatcaccagctgcagtgtggagaaactgatagag
ggccacgagtaccagttccgaatttgtgccgaaaataaatatggagtgggcgatccaatc
ttaactgaaccagcaattgctaaaaacccatatgacccaccaggacgttgtgatcctcct
gtcattagtaacataaccaaagatcacatgactgtaagctggaaaccaccagcagatgat
ggcggctcatccatcactggctatttggttgagaagcgggaaacccaggcagttaattgg
actaaggtcaacaggaaacctgttatagaaagaactatcaaagcaacaggtctccaagaa
ggcaccgaatacgagttccgagttacagccataaataaggctggcccaggcaagcccagt
gatgcatccaaagctgtttatgctcgggaccctctgtatcctcctggcccaccagctttt
cctaaagtgtatgatacaacccgtagctctgtgagtctttcttggggcaagccagcctat
gatggtggtagccctatcattggttaccttgttgaagcaaaacgagctgactctgttaac
tgggtgaggtgcaatttaccagataagctgcagaaaacccgctttgaggtcaccggcctg
atggaaaacatagaatatcaattccgtgtgtacgccgttaataaggttggctacagtgac
cccagtgatgtgccagacaaccactgtccaaaggatatcctaattccacctgagggagaa
ctggatgctgatttgaggaagacaattatattacgtgctggcgttacattgagactatat
gtaccagtaaaaggacgtccacctccaaagatcacttggtctaaaccggatgccaatcta
agagaaaggattggactggacataaagtcaaccgactttgacactttcttgcgctgtgaa
aatgtgaacaaatatgatgcaggaaaatatatcttgactctggagaacagctgtggtaaa
aaggaatataccattgtggtgaaagtgctggatactcctgggccacctgtcaatgtgact
gttaaggaaatatccaaagattctgcttatattacttgggatcctcccattattgatggt
ggaagccccatcataaactatgtggtagaaaagcgtgacgcagagaggaagtcctggtct
acagtggcaacggagtgccccaaaacaagcttcagggtatctaacttggaggagggcaag
tcctacttcttccgggtgtttgctgaaaatgagtacggcattggtgatcccggtgaaaca
cgtgatgccgtcaaagcttccgaaaccccgggaccagttgtggatctgaaagtgagatct
gtaaataagtcatcttgtaccatcggctggaaaaagcctcgcagcgatggtggaagcaga
attaccggatatgtagtcgatttcctaactgacgaaaataagtggcaacgagttatgcaa
gcattaaacttacagtactttgcaaaagatttgatagaagggaaggaatataccttcagg
gtgagtgctgagaatgaaaatggagaaggaaccccaagcgaaatcgtcgtcgtggcaaag
gatgatgttgtggctcctgaccttgacttaaaggatctacctgatttgtgctacttggcc
aaagaaaacagcaacttccgtcttaagatccccataaaaggcaagccaaccccatcggtg
tcctggaagaaaggggaagaccctctagcaactgacacaagagtcagtgtggagtcatct
gcagttaacaccacccttgtcgtacgggactgccaaaaatctgatgccggaaaatacacg
atcacactgaaaaatgtcgctggcacgaaggaaggaactctctctataaaagttgttggc
aaacctggcatccccactgggccaatcaaatttgatgaggtcacagcagaagccataacc
ttaaagtggggtcccccaaaagatgacggaggctctgaaatcaccaactatatcctggag
aagagagactctgtaaacaacaagtgggtgacctgcgcctcggctgtccagaaaaccacc
ttcagagtaaccaggcttcatgagggcatggagtacaccttcagggtcagtgccgaaaac
aaatatggtgtaggagagggcctgaagtcagagccaattgtcgctaaacatcctttcgat
gtgcccgatgctcccccacctcccaacattgtggatgtcagacatgactcggtagctcta
acctggacggaccccaggaaaaccggtggctctccaattacagggtatcatatcgagttc
aaggaaagaaacagccttttgtggaagagagcgaacaagactcctattaggatgaaagac
ttcagagtgacaggattaactgaaggtctggaatatgagttccgagtgatggcaatcaat
ttggcaggagtaggcaagccaagcctgccatcggagcctgttgtggcactggatcccatt
gatcctcctggcaagcctgaggttatcagtgtaacaaggaactcagtgactctcatttgg
actgagcccaaatacgatggtggccataagttgactggatacatagtggagaagcgggac
ctaccttccaaatcttggatgaaagcaaaccatgttaatgtccccgattgtgtctttact
gtaactgaccttgtggaaggtggaaaatatgaattcagaattagagcaaagaatacagca
ggtgctatcagtgccccatcagaaagtacaggaaccattatttgcaaggatgaatatgag
gcaccaaccattgtccttgatcctacaataaaagatgggctaacggtgaaagcaggagag
accattgttttgagcgccattagcattcttggcaaaccccttcccaagtcaaactggtcc
aaggcaggaaaggacattagactatcagatgtcgttcagatcacttccaccccaacatct
tccatgcttgctgtcaagtatgccactagaaaagatgcgggtgaatacaccatcactgct
accaatccttttggcacgaaggaggaacacgtgaaggtgacagttctcgatgtacctggt
cccccaggtcccattgaaatcagtaatgtttctgctgaaaaagcaacacttacatggaca
cctcccttggaagatggcggctcaccaattaagtcctatgttcttgaaaagagggaaacc
agccgactcttgtggacagtggttgctgaagatattcagtcttgcaggcatgtggtaacc
aaactcatccaaggaaatgagtacctcttccgggtctcggctgtaaaccagtatggcaaa
ggagaaccggtggagtctgaacctgtcaaaatggtagacagatttggtccccctggccct
cctgaaaaaccagaggtatcaaatgtcactaaaaacactgccactgtcagttggaaaaga
ccagctgatgatggtggtagtgagatcacaggatatcatgtggaaaggcgagaaaagaaa
agcttgagatgggtgagagcaacaaagacaccagtctccgacctcagatgcaaagtcaca
ggacttcaggaaggaaacacctacgaattccgcgtcagtgcagaaaacagagcaggaatt
ggtcctcctagtgaggcttcaaatcttgttttaatgaaagatgcagcatatcctccagga
ccacctacaaatgcacatgtcactgatactacgaagaaatctgcttctttagcatggggc
aagcctcattatgatggtggacttgaaatcactggctatatcgtagagcatcaaaaagta
ggagaggaggcctggataaaagataccacgggaactgccctcagaatcactcagtttgtt
gtccctgatcttcagactaaagaaaaatacaattttagaatcagtgccgtcaatgatgca
ggtgttggggagccagcagtggttccagatgttgaaattgtagaaagggaaatggttcct
gatttcgaactagatgctgagcttcgaaggacccttgttgttagagcaggactcagtatt
agaatatttgtgccaatcaaaggtcgtcctgctcctgaagtgacatggaccaaggatgat
atcaaccttaaaacccgagcaaacattgaaaacacagaatcattcactcttctgattatc
ccagaatgcaacagatatgacaccggtaaatttgtgatgactatcgaaaaccctgccggg
aagaaaagtggctttgtcaacgtcagagtcttggatacaccagaacccgtccttaacctg
aggcctactgacatcacaaaggacagtgtcaccctgcactgggacctccctctggtggat
gggggctcacgtataacaaactatattgtggagaaacgagaagcaacacgaaaatcttac
accacagtcaccactaagtgccataaatgcacatataaagttaccggcttgaccgaagga
tgtgaatacttcttcagagtgatggcagagaatgaatacggaattggtgtcccaacagaa
acaacagaacctgtgaaagcctccgaagcacctttacctccagaaagtctgaacatcatg
gacataaccaagagcacggtcagcctggcatggcccaaaccaaaacacgatggtggcagt
aagatcactggctacgtgattgaagcccagaggaaaggctctgaccagtggacccacatt
acaaccgtgaaagggttagaatgtgtggtgaggaatctcactgaaggggaagaatacacc
ttccaagtgatggcagtgaacagtgcagggcgaagtgcccccagagaaagcagacctgtc
attgtcaaggagcagacaatgctcccagaattggatctccgtggcatttatcagaaatta
gtcattgccagagctggtgacaacatcaaagtagaaattccagtgcttggtcgaccaaag
cccaccgtgacatggaaaaaaggagaccagattcttaaacaaacacagagagttaatatt
gaaaatacagcaacttcaaccatcttaaatatcaacgagtgtgtaagaagtgatagtggg
ccctacccattaactgcaaagaacattgtaggagaggttggtgatgtcgtcaccattcaa
gtccatgatattccaggaccacctactggcccaatcaaattcgatgaagtttcatctgat
tttgtaaccttctcctgggacccacctgagaacgatggaggggtaccaataagcaactat
gtaatagaaatgcgacagactgacagtactacatggaccgaactagcaagcactgttatt
cgcactacctataaagccacccgccttactaccggagtggaatatcaattccgggtaaga
gctcagaatagatacggagttggaccaggcatcacatcagcatcaatagttgccaattat
ccatttaaggttcctgggcctcctggtacccctcaggtaactgcagttaccaaggactca
atgacaattagctggcatgaacctctctctgacggtggaagccccattttaggatatcat
gttgaaagaaaagaacgaaatggtatactctggcagaatgtgagcaaagcattagtgcca
ggcaacattttcaaatcaactggacttacagatggtattgcttatgagttccgagtgatt
gcagaaaacatggcaggcaaaagcaagccaagcaagccatctgagcccatgcttgctttg
gatcccatcgacccacctgggaaaccagttcctctgaatattactagacacaccgtgacc
cttaaatgggctaagccagaatatactggaggctttaaaattactagttacatagttgaa
aagagagacctccctaatggacggtggctgaaggccaacttcagcaacattttggagaat
gaatttacagtcagtggcctaacagaagatgctgcatatgaattccgcgtgattgccaaa
aatgctgctggtgctattagtccaccatctgagccatcggatgctatcacgtgcagggat
gacattgaagcaccaaggatcatggtggatattaaatttaaggacacaattatactaaaa
gcaggtgaagcattcaagctggaagctgatgtttcaggtcgccctcctccaacaatggaa
tggaccaaagatggaaaggagctggaaggcacagggaaattagaaataaaaattgcagat
ttctctactactctggtaaacaaggattcattaagaagggatggtggtgcctataccctt
acagcaactaatcctggaggttttgccaaacatattttcaatgtcaaagttcttgataga
ccaggcccaccggaaggacccttagttgtatctgatgtgacatcagaaaaatgtgtattg
tcctggttgcctccacgggatgatggaggtgccaaaattgatcattatgtggttcagaaa
cgtgaaaccagcagattggcatggacaaatgtagccgcagaagtccaagtaacaaaacta
aaggttactaaacttttgaaaggcaatgaatacatcttccgcgttatggcagtaaataaa
tatggggtcggagagccactggaatcagagcctgtgcttgcagtggatccttatggaccc
cctgatccacccaaaaaccctgaagtcacaactattactaaagattcaatggtagtctgc
tggggacatcctgactctgatggtggaagtgaaatcataaactatattgtggaacggcgt
gataaagctgggcaacgctgggtgaaatgcaacaaaaaaactgttactgatttaagattt
aaagtgtctggactgaccgaaggacacgaatatgagttcaggattatggctgagaatgct
gctggaattagtgcaccaagctctaccagtccattttacaaggcttgtgatgctgtgttt
aaacctggcccaccaggtaacccacgtgtcctagattcaagcagatcatccatctcaatt
gcttggaataaacccatctatgatggcggctccgaaatcaccgggtatatggttgagatt
gcccttccagaggaagatgaatggcagattgtcactccgccagctggtctcaaggcaacg
tcttacaccatcaccaatctcatagagaatcaggagtataaaatccggatctatgccatg
aattctgaaggaattggagaacctgcacttgttcccggaactccaaaggctgaagacagg
ttgctgcctccagagattgaactggatgctgacctgcgcaaagttgttactataagagct
tgttgtactctgagactttttgttccaatcaaaggcaggcctgcgcctgaggtgaagtgg
agccgggaacatggagaatctttggataaagctagcattgattccaccagctcttacacc
ctgcttattgttggaaatgttaacagattcgacagtggcaaatacatactaactatagaa
aacagctcaggcagcaaatctgcatttgtcaatgttagggtactggatacaccaggccct
ccccaggatctgaaggtaaaggaggtcactaagacgtctgtcacattgacatgggagcct
cctctccttgatggaggttcaaaaataaagaactacgttgttgaaaagcgggagtcaaca
agaaaagcatattcaactgttgcaacaaattgccacaagacttcctggaaggtagaccag
cttcaagaaggctgtagttactatttcagggttcttgctgaaaatgaatatggcatcggg
ctgcctgctgaaactgcagaatctgtgaaagcatcagaacgacctcttcctccaggaaaa
ataactttggtggatgtcacaagaaacagcgtgtcgctttcttgggagaaaccagagcat
gatggaggcagccgaattctaggctatattgtagagatgcagagcaaaggtagtgacaaa
tgggtcacgtgtgccacagtcaaagtcactgaagccactataactggattaattcagggt
gaagaatactctttccgtgtttcagctcagaatgaaaagggcatcagtgatcctagacaa
ctgagtgtgccagtaattgccaaagatcttgtcattccaccagccttcaaactcctcttt
aatactttcactgtactggcaggtgaagacctaaaagttgatgttccattcattggacgc
cctccaccagctgtaacctggcttaaagatgaggtgccactgaagcagacaactagagta
aatgcagagagcaccgaaaataattcattattgacaataaaggaagcctgccgcgaagat
gttggacattacacggttaaactgacaaactcagctggtgaagctactgaaattcttaat
gttgttgttcttgacaagccagggcctccgactggaccagttaaaatagatgaagtgacg
gctgatagtattactctttcctggggcccacctaaatatgatggtggaagttctatcaat
aattacattgtagaaaaacgggacacttccaccaccacctggcaaattgtgtcagctact
gttgcaaggacaacaataaaagcttgcagattaaagaccggatgtgaatatcagtttagg
attgcagctgaaaacagatacggaaagagcacctacctcaattcagagcctattgtagcc
cagtatccattcaaagttcctggtcctcctggcacaccatttgtaacactctcctccaag
gacagcatggaagtacgatggaacgagccagtcaatgatggaggtagcaaagtcattggc
tatcatctagaacgcaaggaaagaaatagcatcctctgggttaagttgaataaaacgcct
attcctcaaaccaagtttaaaacaactggccttgaggaaggcattgaatatgaatttaga
gtctctgcagagaacatcgtgggcattggcaagccaagcaaagtgtcagaatgctacgta
gctcgtgacccatgtgatccaccagggcggccagaggcaatcattgtcacacggaattct
gtgactcttcagtggaagaaacccacctatgatggtggaagcaagatcactggttatatt
gttgagaagaaagaactacctgagggccgttggatgaaagctagttttacaaatgtcatt
gacactcaatttgaagtaactggcctggttgaagatcataggtatgagttccgggttata
gctcgaaatgctgcgggagtgttgagcgagccatcggaaagcacaggagcaataactgca
agagatgaggtagatccaccacgaataagtatggatcccaaatacaaagaaacaattgtg
gtccatgctggtgaattcttcaagattgatgcagatgttcatggcaaaccaatcccaact
actcaatggctaaaaggtgatcaggagctatcaaatacaactcgactagaaataaagagc
actgactttgccaccagtctcagcgtaaaggatgcagtacgcattgacagtggaaattac
atactgaaggccagaaatgttgcaggcgagagatcagttaccgtaaatgtcaaagttctt
gataaaccagggccgcctgaaggacctgttgttataacaggagttacagcagaaaaatgc
acactggcttggaaacccccactacaggatggtgggagtgatatcataaattatattgtg
gaaaggagagaaaccagccgcttagtttggactgtggttgatgccaacgtgcaaactctc
agctgcaaggtgactaagcttcttgaaggcaatgaatatatgttccgtataatggctgta
aacaaatatggtgttggcgaacctcttgaatctgagccagtaattgctaagaatccattt
gtagtaccagatgcaccaaaggctccagaaatcacagcagtgaccaaggactcaatgatt
gttgtatgggaaaggccagcatctgatggtggcagtgaaattcttggatatgttcttgaa
aaacgagataaagagggcatccgatggacaagatgccacaaacgtttgattggagaattg
cgcttgagggtaactggactcctagaaaatcacagttatgaattcagagtgtcagctgag
aatgctgctggacttagtgaaccaagcccaccttccgcttaccaaaaggcttgtgatcct
atttataaaccaggacctccaaacaatccaaaagtcacagatattaccaggtcgtctgtc
ttcctttcttggagcaaaccaatatacgatggtggctgtgaaattcaaggatacattgtt
gaacaatgtgatgtgagtgacggtgaatggacaatgtgcactccaccaaccggaatcaat
aaaacaaacttagaagtagagaagctgttggaaaagcatgagtacaacttccgcatctgt
gctgttaataaagctggagttggagaacatgctgatgtccctggacctattctagttgaa
gaaaaattggaagcaccagacattgatcttgacctagaactaaggaaaattatcaatata
agggcaggtggctccttaaggttatttgttcctattaaaggccgtcctacaccagaagtg
aaatgggggaaaatggatggtgaaatccgagatgctgctataattgatgtcactagcagt
ttcacctctcttgttcttgacaatgtcaaccgatatgatagtggaaaatatacactcacc
ttagaaaacagcagtggaacaaagtctgcctttgttactgtgagagtcctagacacacca
agtccacctgtaaacctgaaagtcacagatatcaccaaggactcagtatcaattacatgg
gagcctcctttgctggatggtggctccaaaataaaaaattacattgttgagaaacgcgaa
gccacaagaaaatcatatgctgcagttgtaacaaattgccataagaattcttggaaaatt
gatcaactccaagaaggttgcagttattactttagagtcacagctgaaaatgagtacggt
attggccttcctgcccgcactgctgatccaattaaggttgcagaagtcccacaacctcca
ggaaaaataactgtggatgatgtcaccagaaacagtgtctccttgagttggacaaagcct
gaacatgatggtggcagtaaaataattcagtatattgtggaaatgcaagctaaacagagt
gagaaatggtcagagtgtgcacgagtcaagtcccttgaagcagtgatttccaacctaact
cagggagaggaatatctttttagagttgttgctgtaaatgaaaagggaagaagtgatcct
aggtcccttgcagttccaatagttgccaaagatctggtcattgagccagatgtaagacct
gcattcaataattatagtgtacaggttggacaagacttgaaaatagaagtgccaatttct
ggacgtcctaagccaaccattacatggactaaagatggtgctccactgaagcagactaca
agaatcaatgttacagattcacttgacctcactgtactcagtattaaagaaactcataag
gatgatggtggacattatggaatcacagttgctaatattgttggtcagaaaacagcatcc
attgaaattataactctagataaacctgatcctccacaaggacctgttaaatttgatgaa
gtcagtgccgaaagtattacattatcttggaaccctccattatataccgggggttgccag
atcaccaactacattgttcagaaaagagatacaaccaccaccgtatgggaagttgtttct
gctactgttgccagaactacactcaaagtaaccaaactgaaaactggtacggaataccaa
ttcagaatatttgctgaaaacagatatggacaaagctttggcttggattctagtccaatt
gtagctcaatatccctacaaagaacctggccctccaggcacaccatttgtcacagccatt
tccaaagagtccatggttgtacagtggcatgaaccaatcaataatggtggaagcccagtt
ataggttaccaccttgaaagaaaggaaagaaatagtattttgtggacaaaagtcaacaaa
actattattcatgacacccagtttaaagcagtcaatcttgaagaaggcattgaatatgaa
ttcagagtttatgctgaaaatattgttggtgtaggcaaagcaagcaagaattctgaatgc
tatgtagccagagatccctgtgacccaccaggaaccccagaagcaataattgttaaaaga
aatgagatcactttacaatggaccaaacccgtatatgatggtggaagtatgattacaggt
tacattgtagaaaaacgtgatttgcctgatggtcgttggatgaaagctagtttcacaaat
gtcattgaaactcaatttactgtgtcaggccttactgaagatcaaaggtatgaattcaga
gtcattgcaaagaatgcagctggtacagtaagtaaaccctctgacagtactggaccaata
actgccaaggatgaggttgaactcccacgaatttcaatggatccaaaattcagagacaca
attgtggttaatgccggagaaacattcaggcttgaggctgatgtccgtggaaagcccctg
cctaccattgagtggttaagaggagataaagaagttgaagaatctgctagatgtgaaata
aaaaacacagatttcaaggctttacttattataaaagatgccattagaattgatggtgga
cagtatattttaagagcttccaatgttgcaggttctaagtcattcccggtaaatgtgaaa
gtgttagatagaccgggacctccagaaggaccagttcaggttactggagtcactgctgaa
aaatgcactttaacgtggtctccaccactacaagatggtggcagtgacatttctcactat
gttgttgaaaagagagaaacgagtcggcttgcctggactgttgttgcttcccaagttgtg
accaactctctgaaagtaaccaaactcttagaaggaaatgaatatattttccgtataatg
gctgtcaacaaatatggtgttggagagcctttggaatctgcaccagtactgatgaaaaat
ccatttgtgctccctggaccaccaaaaagcctggaagtcacgaacatcgccaaggactcc
atgactgtctgttggaaccgtccagatagtgatggtggaagtgagattattggttacatc
gtagagaaaagagacagaagtggcattaggtggataaaatgtaataaacgccgcattaca
gatttgcgtctaagagtaacaggattaacagaagatcatgagtatgaattccgagtctct
gcagaaaatgctgctggagttggagaaccaagtccagcgacagtttattataaggcttgt
gatcctgtgtttaagcctggcccacccaccaatgcacacactgtagacaccactaaaaat
tcaattacagttgcctggggtaaacccatctatgatggtggcagtgagatcctgggatat
gtagtagaaatctgtacggcagacgaagaagaatggcaaataattactccaccaactggc
ctgaaagccactcgatttgaaatttcaaaactcactgaacaccaagagtataaaatacga
gtctgtgccctcaataaagttggcttgggtgaggctacatccgttcctggtactgtgaaa
ccagaagataaacttgaagcacctgaacttgaccttgattctgaattaaggaaagggatt
gtggtaagagctggtgggtctgccagaattcacattccattcaaaggccgtccaacacct
gagatcacttggtctcgagaggaaggtgaattcacagataaggttcaaattgaaaagggt
gtaaactatacccatctatcaatagataactgtgatagaaatgatgctggaaaatatatt
ctcaagctggaaaatagtagtggatctaaatctgcttttgtgacggtgaaagttctggat
accccaggaccaccacagaacttgacagtcaaagaagtgaaaaaagactctgtcatcttg
gtgtgggaaccacccatcattgatggaggtgcaaagatcaagaactatgttattgacaaa
cgtgagtcaaccagaaaagcgtatgctaatgtgagcaataaatgcagcaaaacaagcttt
aaagttgagaatcttacagaaggatccatttattactttagagttatggctgaaaatgaa
tttggagttggtgttccagtagaaactgttgatgctgtgaaagctgctgaacctccttcc
accaggaaaggtaacctcctcccaccaggaaaggttacactcactgatgtgtctcagacc
agtgcatcacttatgtgggagaaacctgaacatgatggtggtagcagaatcctggggtat
gttgttgaaatgcagcccaagggaactgaaaaatggagtgttgtggctgaatccaaagtc
tgtaatgcagttgttactggtttgagttctggacaagagtatcagttccgtgtcaaggct
tacaatgagaaaggaaaaagtgatccaagagtgcttggtgttccagtcatagccaaggac
ttgactatacagcctagtcttcagttgccattcaatacatatactgtccaagctggagaa
gatcttaaaattgaaattccagttattggccgaccaagacctaaaatttcatggatcaaa
gatggtgagactcttaaacagacaacaagagtaaatattgaggaaacagctacttcaact
attttgcacattaaagaaagtaacaaagatgactttggaaaatacaccataacagcaaca
aacagtgcaggggaggcaacagaaaatctcagcgttatcgtcttggaaaagcctggacct
ccagttggacctgttcggtttgatgaagttagtgcagactttgtggtcatatcttgggaa
cctccagcctatactggtggctgccaaataagcaactacattgtagaaaagcgcgataca
accactaccacttggcaaatggtatcagcaacagttgcaagaacaacaattaaaataagc
aaactgagaacaggcacagaataccagtttagaatttttgctgaaaacaggtatggaaaa
agtacccctctggattctaaaccagttgttgtacaatatccatttaaagtccctggacca
cctggaactccttttgtgacatccatctcaaaagatcaaatgcttgttcagtggcatgag
ccagttaatgatggaggtagcaaagttattggctaccatctggaacagaaagaaaagaac
agcattttatggatcaaattaaataagagtcccattcaagataccaaattcaaaacaact
gggcttgatgaaggccttgagtatgagttcaaagtttctgctgaaaatattgttggcatc
ggtaagcctagcaaagtgtccgaatgttttgttgcccgtgacccatgtgacccacctggt
cgccctgaagccattgttattacaagaaacagtgtcacactaacatggaagaaacctgcc
tatgatggtggtagcaaaataacaggttacattgtagagaagaaagacctacctgatggc
cgttggatgaaagccagctttaccaatgtattagaaactgaatttacagtgagtggactt
gtagaagaccaaagatatgaatttagagtaattgcaagaaatgcagctggcaactttagt
gaaccatctgaaagcacgggtgccattactgcaagagatgaaattgatgcaccaaatgcc
tcattggatccaaaatatagagatgtcatcattgttcacgcaggagagacttttgtcctt
gaagctgatatccgcggcaaacctatacctgatattgtttggttaaaagatggaaaagag
cttgaagaaacagcggctaggatggaaatcaaatctactcttcagaaaacaactctcatt
gtcaaagactgcatacgtactgatggaggacaatacattctgaaactgagcaatgtaggc
ggtacaaagtctataccaatcactgtaaaggtacgtgacaggccagggcctcctgaaggg
cctctcaaagtttctggggttactgctgaaaaatgttacctggcatggaacccaccttta
caagacggcggtgctaatatttcacattacatcattgaaaagagagagacaagcagactt
tcctggacccaggtttcaactgaggtacaggcccttaactacaaagtcaccaaacttctt
cctggtaatgagtacattttccgtgtcatggctgttaataagtatggcattggagagccc
ttggaatctgagcctgtcatagcctgtaatccttataaaccaccaggtcctccttcacca
cctgaagtctcagcaatcaccaaagattctatggtggtaacatggacacgcccagtggat
gacggaggtgctgaaattgagggttatattcttgaaaaacgagataaggaaggcatcaga
tggatcaagtgtaacaagaaaacactaacagacctccgaatgagggtaactggcctcacc
gaaggtcattcctatgaattcagagttgcagctgaaaatgcagctggtgtgggtgaacct
agtgagccatctgttttctatcgtgcatgtgatgctttgtacccaccaggtccaccaagt
aatccaaaagtgacagacacttccaggtcctctgtctcccttgcatggaataagccaatt
tacgatggtggtgcccctgttaagggctatgttattgaagtcaaagaagccactgccgat
gaatggacaacttgcactccaccaacaggattacaaggaaagcagttcacagtgactgag
cttaaagaaaatactgaatataatttccgtatttgtgccatcaattctgaaggtgtaggt
gaacctgcaactatacctggttcagttgttgctcaagatcggctagaaccaccagaaata
gaacttgatgctgatctcagaaaggtggtcattctccgtgcaagcactactttacgctta
tttgtcactatcaaaggtcgaccggaacctgaagttaaatgggaaaaggctgatgccatt
ctcactgagagggcccagattgaggtgaccagttcatatacaatgttggtcattgataat
gttaccagatttgacagtggccggtataatctgacactagaaaataacagtggctccaaa
acagcttttgttaatgtcagagttcttgactcaccaagtgccccggtgaatttgactgta
agagaagtgaagaaagactcggtgacattgtcttgggaaccaccacttattgatggagga
gctaagattacaaactacatcgtcgaaaaacgagaagctacaaggaaagcatatgctacc
gtgacaaacaattgcactaagaacacttttaaaattgaaaatctacaagaaggatgttct
tactacttccgagtcttggcatccaatgaatatgggattggtttgccagctgaaacaact
gaatccatcaaagcttctgaagcaccgctcccacctggaagagtaactcttgttgatgtg
actcgtaacacagctacaattaagtgggaaaaaccagaaagtgacggtggcagcaaaatt
actggttatgtagttgaaatgcagactaaagggagtgagaaatggagcacttgcacacaa
gttaagactctagaagcaactatatctggcctaactacaggagaagagtatgtcttcagg
gtagctgcagttaatgaaaaaggaagaagtgattcaagacaacttggagtgccagtaatt
gcaagggatattgaaatagagccttcagttgagcttcctttcaatactttcaatgtaaag
gctagagaccaacttaagatcgatattccattcaaaggaagacctcaagctactataagc
tggaaaaaagatgaccagattcttaaggagacaaccagagtcaatgttacttcttcaaag
actgtaacatcactgtctattaaggaagcttcaagggaagatgttggaacttatgaatta
tgtgtttcaaacagtgctggatccataacagttcctattacagtaattgtccttgacaaa
ccaggacctccaggacctatacgtattgatgaggttagctgtgacaatataactatttct
tggagtcctccagaatatgatggtggctgccaaataagcaactatattgttgaaaagaga
gaaactacttccacaacatggcatgtagtttcacaaacagttgtaagaacatccattaaa
atagtgcgtctgacaacaggaagtgagtatcagttccgtgtttgtgcagaaaaccgctat
ggaaagagctcctacagtgaatcctcagctgttgttgcagagtatccattcagtccccca
ggacctcctggtacgcctaaagttgtgcatgccacaaaatctaccatgatggtcagctgg
caagtaccagttaatgatggaggaagtcaagtaattgggtatcaccttgaatataaagaa
agaagcagcattctttggtcaaaagcaaataaaattctcatccccaatactcaaatgaaa
gtctctggccttgatgaaggactgatgtatgagtaccgtgtatatgctgtgaatattgct
ggaatcggtaaatgcagtaaagcttgtgaaccagttcctgcacgagatccctgtgaccct
cctggacaacctgaagtcacaaatatcacaagaaaatccgtgtcacttaaatggtctaaa
ccacgttatgatggtggcgctaagatcacaggatacattattgaacgtagagaactacca
gatggccggtggctgaagtgcaattttactaacgtacaagaaacatactttgaagtcact
gaacttactgaagatcagcgttatgaattccgggtttttgcaaggaatgctgctgactca
gttagtgaaccctctgaatccactggacctattacagttaaagacgatgttgaggctcca
agaattatgatggatgtcaagttccgagatgttattgttgtcaaagctggagaagtcctt
aagataaatgctgacattgcagggcgaccgctgccagtagtttcctggaccaaggatggt
gtagaaattgaagaacgagcaagaatagaaattgtctcaacggactataatactttgtta
acagtgaaagactgtgtcagacgagacactgggcagtatgtactaacactgaagaatgtt
gcaggaactcggtctatggcagttaattgcaaagtacttgataagcccggcccaccagca
ggaccgattgagataaatggcctcacctctgaaaaatgctctctttcctggggacctcct
caagaagatggcggtgcaagtatcgaccattacattgtagaaaaacgtgaaacaagccgc
cttgcatggacaatttgtgaaggagagttaaagacaacatcctgtaaaataaccaaatta
ctcaaaggcaatgaatacatctttagagtaacaggtgttaataaatatggtgttggtgag
cccctagagagtgtggctgtaaaggccctagacccatttacagtcccaagtcctcccaca
tctttggaaattacatctgtgaccaaagagttcatgacactttgctggtcgagacctgag
agtgatggaggcagtgagatctctggatatatcattgaaaggcgagagaaaagtggtcta
cgatgggtgcgtgtaaacaaaaaaccagtttatgatttgagagtgaaatcaacaggactc
cgggaaggatgtgaatatgagtatagagtttttgcagaaaacgctgctggcctaagcctt
ccaagtgaaacctctcccttaatccgggcagaagatccagtgttcttaccatctcctcca
tccaaaccgaaagttgtagactctggcaagacaaatataactattagctgggttaagcct
ttatttgatggtggggccccaataactggatacactgtggaatacaaaacatccgatgaa
actgactggacagttgccattcagagcttaagaggcaccgaatatacaataaatggacta
acaacaggagccgaatatattttcagagtaaggtctgtcaataaggtgggtgctagtgat
cccagtgatagttctgatccccagatagcaaaagaaagagaagaagaacctgtatttgat
cttgacagtgaaatgaagaagaccttgattgtcaaggctggtgcctcgttcaccatgact
gtgcctttccgaggaagaccggtacccaatgtctcgtggagtaaaccagacactgacctc
cgcattcgagcttacattgattccacagactctcgtacctctcttactatcgaaaatgcc
aaccgaaatgattctggaaaatacacattaacaattcagaatcatttgaatgctgtttca
ctgaccttagttgtcaaagttttagattctcctggtcctccagccaatatttctgtacat
gatgtcaccaaagaatctgctgtgttatcctgggatgtgcctgaaaacgacggtggagca
ccagtgaagaattaccacatagaaaaacgtgaggccagcaagaaagcgtgggtctctgta
accaacaattgtaaccgcctctcctacaaagttaccaacctacaagaaggggcgatctac
tacttcagagtctttggagaaaatgagtttggtgttggtgtaccagctgaaacacaggaa
ggagtaaaaataacagaaaaaccaagcccacctgaaaaacttggagtaacaagtgtatcc
aaagatagtgtttccctggcctggttgaagccagaacacgatggtggaagcagaattgta
cactatcttgttgaagcactagaaaaaggacagaaaaattgggtgaaatgtgccgtggta
aagtcaacccatcacgttgtttctagtctgagggaaaactctgaatactttttccgggtg
tttgctgaaaaccaagctggtttgagtgacccgagagagctgcttcttcctgttcttgtt
aaggagcaactagaaccacctgaaattgatatgaagaatttcccaagtcagactgtgtat
gttagagctggttcgaaccttaaagttgacattccaatttctggaaaaccactgcccaaa
gtgaccttatcaagagatggtgtacccctgaaggcaaccatgagatttaatactgaagtt
actgctgagaacctaaccattaatctgaaagaaagcgttgctgctgatgctggaagatat
gagatcacagctgccaactccagtggaacgaccaaagcttttattaacatcattgtgcta
gacaggcctggtcccccaactggccctattgttattggtgatataactgaagaaagtgtg
actctcaaatgggagccacctaagtatgatggcggaagtaatgtcaccaattacattgta
ctcaagagagagacaagtacggcagtatggactgaagtgtctgccacagttgcaagaacc
atgattaaagtcatgaaattgaccaaaggagaagaataccaattccgcatcaaggcagaa
aaccgctttggaatcagtgatcacatagattcagcttatgtggttgtcaaactgccctac
acaacacctggaccgccatctacaccatggatcaatcatgttactcgagaaagcatcacc
gtgggctggcatgaaccagtgtccaatggaggcaatgcagttataggctatcacctggaa
atgaaagacagaaacagtattttatggcaaaaagtcaacaaaatggtcatccgcacaact
cacttcaaagtcacaacgatcagtgctggacttatttatgaattcagggtgtatgcggaa
aacgctgctggtattgggaaaccaagccacccgtctgagccagtcctagccatagatgcc
tgtgaaccaccaagaaatgtccgtatcactgatatttcaaagaattctgtcaacctttca
tggcaaccaccagctttcgatggaggaagcaagattacaggctatattgttgaaagacga
gatcttccggagggcaggtggaccaaagccagcttcaccaatgtcattgagactcaattc
actgtgtctggcttgactcagaattcgcagtatgaattccgtgtctttgctagaaatgct
gttggttccatcagcaatccgtccgaggtggtgggccccgttacctgcattgatacttat
ggtggacctgtaattgatttacctctagaatatacagaagttgtcaaatacagagcaggt
acatctgtgaagctcagagctggcatttctggcaaacctgagcctacaattgagtggtat
aaagatgataaagaattacaaaccaatgcactggtgtgtgtcgaaaataccactgacctt
gcgtctatactcatcaaagatgcaagtcgccttaatagtggaagctatgaattaaaactc
aggaatgaaaaaatgggcgcacagtcagccaccatcagagtacagatccttgacaaacca
ggaccaccaggtggaccaattgaatttaagactgtcactgctgaaaagatgacgcttctc
tggcggcctccagaggatgacggtggtgccaaaatcactcactacatcgtggaaaagcgt
gaaacaagccgcgttgtgtggtctatggtgtctgaaaatctagaagagtgcatcattaca
accaccaaaattatcaaaggaaatgagtacatcttccgggttcgagccgtgaacaaatac
ggaattggtgatccactggaatctgatccagtggtagcaaagaatgcatttgttacacca
gggcctccaagcataccagaggtgacaaagataaccaagaatgcaatgactgttgtctgg
aacagaccagttgcagatggcgggaatgaaataattggctatttccttgagaaacgagac
aagaagagtctaggatggtttaaagtcctaaaggagactatccgtgacaccagacagaaa
gtgacaggactcacggaaaacagtgactatcaataccgagtttgtgctgtgaacgctgct
ggacagggtccattttcggaaccatctgacttctacaaagctgctgatcctatcgatcct
ccaggcccaccggctaagataagaatttcagatacaactaaatcatccattactcttgcc
tggagtaaacctgtctatgatgggggcagtgctgttactggctatgttgtcgagatgaga
caaggagaggaagaggaatggactattgtctctaccaaagaagaagtcagaactacagaa
tatgtggtatctaacctgaaacctggagtcaattactacttccaggtgtctgctgtaaac
tgtgctgggcaaggagaacctatagtaatgactgaacctgcacaagctaaagatatactt
gaggaaccagagatcaacctagatgtggctttcagaacctctatcatcgccaaagcgggt
gaagatgtccaagtatttattccctttaaaggcagacctccacctactgtcacgtggaga
aaagatgacaagaatcttggcagtgatgtcagatacagcattcaaaacactgattcatct
tcattactcattattcctcaagtgactcgcaatgatacaggaaaatatattctcacaata
gaaaatggagttggtgaacccaagtcttcaactgtgagtgtcaaagtgcttgatacgcca
gccgcctgccagaaactacatattaaacatgtttctcaaggcacagtcactctgttctgg
gatcctcctctcattgatggaggatcgcccataattaattatgtcattcaaaagagagac
gccaccaagagaacatggtctgcagtggcaaacaaatgttctagtacatcctttaaggta
acagatttgtcggagaaaacaccattcttcttcagagttcttgcggaaaatgaaattggc
attggggaaccctgtgaaaccacagagccagtgaaggctgctgaagtaccagctcctata
cgtgatctctcagtgaaagattcatcaaagacatctgttaccctgagctggaccaagccc
gactttgatggtggtagtgtcatcacagactatgttgtggaaaggaaaagcagtacagaa
caaacatggtcacatgctggcattagtaagacatgtgaaattgaggttggccaacttaag
gaacagtcagtcctggaattcagagtgtctgccagaaatgagaaaggactgagtgattct
gtcagtattgggccgattacagtgaaagaacttgtaattacacctgaagttgacctgtca
gatatccctggagcacaagtcactgtgagaattgggcataacgtgcacctcgaattacct
tataaaggaaaacccaaaccatctatcagttggatgaaagacggtttgccattgaaagaa
agtgaaaatgtccgtttcagtaaaactgaaaacaaaattactttcaatattaagaatgcc
aaaaaggagaatggagggaaatacacaattattcttgataacgcggtttgtagaaactca
tttcccatcactgtcatcacacttggcccaccatcaaagccaaaaggacccattaaattt
gatgaaatcaaagctgacagtgtcatcatgtcatgggatgtgcccgaagatgatggagga
ggagaaattacttgttacagcattgagaagcgagaagcttcacaaactaattggaagatg
gtgtgctcaagtgttgccaggacgactttcaaagttcctaatttagtcaaagattctgaa
taccaatttagagtgagggcagaaaacagatacggagtcagccagccacttgtctctacc
attattgtggcaaaacaccagttcaggattcctggccccccaggaaagccagttatatac
aatgtgacttctgatggcatgtcactcacttgggatgctccagtttataatggtggttca
gaagttactggattccatgttgaaaagaaagaaagaaatagcatcctctggcaaagagtg
aatacatcaccaatatctggaagagagtatagagctacgggactaatagaaggcctggat
taccagttccgtgtatttgctgaaaattctgccggcctaagctcacctagtgacccaagc
aaatttaccttagctgtttccccagtagacccacctggcactcctgactacattgacgtc
acccgagaaaccatcacacttaaatggaacccaccgttgcgtgatggaggcagtaagatt
gtggcctacagcattgagagacggcaagggagtgatcgttgggttagatgcaactttact
gatgtctgcgaatgtcagtacacagtcacaggactgagtcctggggatcgatatgaattc
agaataattgcaagaaatgccgttggaactataagtcctccttcacagtcttctggcttt
atcatgacaagagatgaaaatgttccaccaacagtagagtttggccctgaatactttgat
ggtctcgtgatcaaagctggagagagtcttagaattaaagctttggtgcaaggacgacca
gtacctcgagtaacttggttcaaagatgaagtagaaattgaaaagaggatgaatatggaa
ataaccgatgttcttggatccaccagcctctttgttagagatgctactcgggaccaccgt
ggtgtatataaagtggaagccaaaaatgtatctggctctgcaaaagcagaaattacagtg
aaagtgcaagatacaccaggaaaagtagttgggccaataagattcaccaatattactggc
gagaagatgaccctgtggtgggatgctccactcaatgatggctgtgctcctgtaacccac
tacatcgttgaaaaacgggaaaccagcagacttgcttgggcactaattgaagataaatgt
gaagcccacagctataccgccattaaactaataaatggcaatgaataccaattccgtgtt
tcggcagttaacaagtttggtgttggcagaccacttgattctgacccagtggttgctcaa
atacaatacactgttcctgatgccccgggcactccagaaccaagtaacgtaacaggcaat
agcattaccatgacatgggcaaggccagaatcagatggtggcaatgaaattcaacagtat
atccttgaaaggagagagaagaaaagcacaagatgggtaaaagtgatcagcaaacgacca
atctctgagacgagattcaaagtcactggtctagtagaaggcaatgagtatgaattccgt
gtcatggctgaaaatgctgcaggaataggacctgccagtgatatctcaagactaatcaaa
tgtagagagccagtcagcccaccaggtgctcccactgtggtcaaagtgacagacacatca
aagacaactgtgagcttagaatggtctaagccagtgtttgatggaggcatggaaataatt
gggtatattattgaaatgtgcaaagctggcttagaagactggcacaaggtaaatgtagag
gcatgtgtgaaaacaagatacacagtcacagatctagaagcaggtgaagaatacaaattc
cgggttagtgctatcaatggtgctgggaaaggagacagctgtgaagtgactggcacaatt
aaagccgttgatcggttaaccgctcctgagttagatattgacgcaaacttcaagcagact
cacgttgttagagctggggccagtatccgcctcttcattgcctaccagggtagaccagct
cctacagctgtatggagcaaacccgactctaaccttagcattcgggctgatatccatata
acagactccttcaccaccctcaccgtggaaaactgcaacagaaatgacgcagggaaatac
acccttactgtggaaaacagcagtggcagtaagtcagtcacattcaccgtcaaggtgcta
gacactccagggccacctggcccgattaccttcaaggatgtgacccgggggtctgttaca
ctgatgtgggatgcccctctccttgatggtggtgcccgaatccatcactacgtggtagag
aaacgagaagcaagtcgccgtagctggcagattatcagtgaaaaatgcactcgtcaaatc
ctcaaggttaatgacctggcagaaggcgttccctactatttccgtgtttctgcagaaaat
gagtatggcattggtgaaccctatgaaatgccagaaccaataatagccacagaacagcct
gctccacctaagagacttgatattgttgacacaagcaaatcctctgccgtcttagcttgg
ctgaaaccagaccatgacggaggcagccgaatcactggctacctgctcgaaatgagacaa
aagggctctgacttctgggttgaagctggtcacaccaagctgctgacattcaccgttgaa
caactggttgagaatacggaatatgaattccgagtgaaggccaagaatgacgctggctac
agtgaacccagggaagccttctcttcggtcatcatcaaagagcctcaaattgagcccact
gctgaccttactggaattaccaatcagctcataacttgcaaagcaggaagcacatttacc
attgatgtgccaatcagtggtcgtcccacccccaaagtaacatggaaactggaagagatg
agacttaaggagacagagcggatgagtataacaacaacaaaagacagaaccaccttgtct
gtaaaagaaagcatgagaggtgactctggaagatacttcttgaccctggaaaatacagct
ggtgttaaaacatttaccatcacagttgtggtcattggaaggccaggtccagtaaccggc
cccatcgaagtctcatctatctcatccgaatcatgtgtcctttcatgggctgaacctaaa
gatgatggaggcagcgagattactaattacatagttgagaagcgtgagtcaggtacaaca
gcttggcagcttatcaattccagtgtcaagcgcactcagattaaagtcactcatctcaca
aaatacatggaatattcattccgtgtcagttcagagaaccgatttggtgtcagcaagcct
ctagaatcagcaccaataattgctgagcatccatttgttccaccaagcgctcctaccaga
cctgaagtctaccacgtgtcagccaatgccatgtctattcgttgggaagaaccctatcat
gatggtggcagtaaaatcattggctactgggttgagaagaaagagcgtaacaccattctt
tgggtgaaagaaaacaaagtgccatgcttagagtgcaactacaaagtgaccaatttggta
gaaggactggaatatcagttcagaacatatgcactcaatgctgcaggtgtgagcaaagcc
agtgaagcttcaagacctgtaatggctcagaacccagttgatgcaccaggaagaccagaa
gtgacagatgtcacaagatcaacagtgtcactgatttggtcagccccattatatgatgga
ggcagcaaggttgtgggctacatcatagagcgtaagccagtcagtgaagttggagatggt
cgctggctgaagtgcaactataccattgtctctgataatttcttcactgtaaccgctctc
agtgaaggagacacttatgaattccgtgtgttggccaagaatgcagcaggcgtcattagc
aaagggtcagaatctacaggccccgtcacttgcagagatgaatatgctccacctaaggct
gaactggacgccagattacagggtgatctggtcaccatcagagcaggctcagatcttgtt
cttgatgctgcagttggtggcaaacctgaacccaaaatcatctggaccaaaggggacaag
gaactagatctctgtgaaaaagtctctttgcagtatactggcaaacgagcaactgctgta
atcaagttctgtgacagaagtgacagtggaaaatacaccttaactgtgaagaatgccggt
gggaccaaggccgtgtctgtcttggtcaaagttcttgatacccctggcccatgtggcaat
ctcaccgtcagcagagtgacggaggagaagtgcacgttagcctggagccttcctcaggag
gatggaggagcagcaataactcactacgttgtggaaaggcgcgagaccagcaggctcaac
tgggtgattgttgagggcgaatgcccaaccctatcctatgtggttaccagactcatcaag
aacaatgaatacatattccgagtgcgggcagtaaacaaatacggccccggtgtgcctgct
gaaacacagccaattgtagccagaaactcattcactattccatcgcaacctggcatgcct
gaagaagttggggctggcaaagagcatatcattattcagtggctaaaacctgaatctgat
ggtggcaatgagatcagcaactacctagtggacaaacgtgagaagaagagcttgcgttgg
acacgtgtcaacaaagactatgtggtgtatgataccagactgaaggtgactggcctgatg
gaaggttgtgcttaccagttccgggtgacggcagtgaatgctgctggcaacagtgaaccc
agcgaggcttccaacttcatctcctgcagagagccatcatatacccccggaccaccttct
gctccaagagttgtagataccaccaagcacagcattagtttggcatggaccaagcccatg
tacgatggtggcgctgacatcataggatacgttcttgagatgcaagagaaggacactgag
caatggtaccgtgtgcataccaatgccacaataagaaatactgagttcacggtggtagac
cttaaaatgggccagaagtactccttcagagttgctgctgtgaatgtgaagggtatgagt
gaatacagcgagtcaattgccgaaattgagcctgtggaaagactagaaataccagatctt
gagcttgcagacgatttaaagaagactgtgaccatcagagctggggcctcattacgcctg
atggtgtctgtatctggaagaccacctcctgtcataacatggagcaagaagggcattgac
cttgcaaaccgggcaattattgacaccactgacagctactctttacttatcgtggataaa
gctaaccggtatgatgctggaaaatacaccattgaagccgaaaatcaatctggcaaaaaa
tcagcaacagtccttgttaaagtatatgatactcccggtccctgtccttcagtgacagtt
aaggaagtatcaagagattctgtgaccattacttgggaaatccccacaattgatggtgga
gctccagtcaacaactacattattgagaagcgtgaagctgccatgagagcattcaaaaca
gtaactaccaaatgcagcaagacagtttaccgaatttctggacttatagaaggaatcatg
tactatttcagagtgttgccagaaaatatttatggcatcggagagccttgtgaaacatct
gatgcagtgctagtctcagaagtgcctttggtgcctacaaaactggaagtggtcgatgtc
accaagtcaactgttacccttgcctgggaaaaaccactctatgatggtggtagccgactc
actggatatgttcttgaggcctccaaagctggcactgacagatggatgaaggttgttaca
ttaaaacccacagtcctagagcacactgttgtttccctaaatgaaggtgaacagttctca
tttagagtaagggcacaaaatgagaaaggtgtgtcagaaccaagagagatcatcacaccc
gtgactatacaagatctcagagtgttgccaacaattgatctctctacgatgcctcaaaag
accatccatgtcccagctggcagaccagtagagctggtgatacctatcgctggtcgtcca
cctcctgctgcttcatggttctttgctggttctaaactaaaagaatcagagcgtatcaca
gttgaaactcagacaaaagtagcaaaattaaccatccgtgagaccactatcagagatact
ggagaatatacacttgaattgaaaaatgtaactggaactacttcagagaccattaaagtt
atcatccttgacaagcctggtccaccaactgggcctatcaaggttgatgaaattgaggat
acttcagttaccatttcctgggaagcacctgaattggatggcggtgctccactgagtggt
tatgtggtagaacaacgtgatgcccaccgtccagggtggctgccagtgtctgaatcagtg
actagaacgacatttaagttcaccagactcaccgaaggaaacgagtatgtgttccgtgtg
gccgcaaccaaccgcttcgggattggctcttacttgcagtcggagatcatagaatgtcgc
agcagcatcagtattcctggacctccagaaacattagagatatttgatgtctcccgtgat
ggcatgacactcacttggtacccaccagaagacgatggtggctcccaagtgaccggatat
attgtggagcgcaaagaagtgagagcagagcgatgggtccgtgtaaataaagtagcagtg
acgatgacgcggtaccgttccactggccttattgaaggcttagaatatgaacaccgtgtc
acggccattaatgtgagagggactggaaaacccggtcgtccttctaaacccatcgttgcc
atggatccaattgctcctccaggaaagccacaaaacccgagagttactgatacaaccagg
acgtccgtttccctggcctggagccctccagaagacgaaggcggatctaaagtcacaggc
tacttgattgaaatgcagaaagtagatcaacatgaatggaccaaatgtaataccacccca
accaagattcgggaatatactctaacacacctacctcagggtgctgaatacagattccgt
atcctcgcttgtaacgctggtggacctggagagcctgctgaggtaccaggaacagtcaaa
atcaccgaaatgcttgaacatcctgatgttgaacttgatgaaagataccaggagggtctc
tttgtaagacaaggtggagtcatcagacttaccattccaatcaaaggaaaaccgtaccca
atatgtaaatggaccaaagaaggccaagatattagtaagcgtgccatgattgcaacctct
gaaacacacactgagcttgtcatcaaagaagcagtcagggatgattctggctcgtacgac
ctggttctggaaaacaaatgtggcaagaaggctgtttacatcaaggtcaaggtgatagga
attcctaacactccagaagggccacttgaatatgatgacatacaagctcgctctgtaagg
gtcagctggagaccccctgccgatgatggtggtgccgacatcttaggctacatccttgag
agacgagaagtgcctaaagccgcctggtataccattgattccagagtccgaggtacatct
ctggtggtaaaaggcctcaaagaaaatgtggaataccatttccgtgtttcagcagaaaac
cagtttggtatcagcaaacccttaaaatccgaggaaccagtcataccaaaaacaccacta
aatcctccagagcctccaagcaatcctccagaagtactcgatgtgaccaagagttctgtc
agcctgtcctggtcccggcccaaagacgatggtggttctcgagttacaggctactacatc
gaacgcaaggagacatcaactgacaagtgggtcaggcacaataagactcagataacgacc
acaatgtacaccctgacggggctcgttcctgatgctgaatatcagttccgagtcatagca
cagaatgatgttggcctaagtgagaccagccctgcttctgaaccaattatttgcaaagat
ccatttgataagccaagccaacctggagaacttgagattctttcaatctccagagatagt
gtcactctacagtgggagaaacctgaatgtgacggtggcaaagacatccttggatactgg
gttgaataccgacaatctggagacagtgcctggaagaagagcaataaggaccgcatcaag
gacaggcaattcacaatagggggtttgctggaagctactgaatatgaattcagagttttt
gctgagaatgaggctgggcttagcagacctcgaagaactgctatgtctgtaaagacaaaa
ctaacatctggagaggcgccaggagtacgcaaagaaatggaggatgttaccaccaaattg
ggtgaagctgctcaactctcatgccagatccttggaaggcctcttcctgacattaaatgg
taccgatttggtaaggagctggtgcaaagccggaagtacaaaatgtcttcagatggacgc
acgcatactctgacagtgatgacagatgaacaagaagatgaaggcgtttatacctgcata
gctactaatgaggttggagagacagaaaccagtagcaagcttctcctgcaagcaacacca
cagttccatcctggttacccactgaaagagaaatactacggtgcggtgggctcaacactt
cgacttcatgttatgtacattggtcgtccagtacctgccatcacttggttccatggccag
aaacttctgcaaaactcagaaaacactgctattgaaaacactgagcactacactcatctc
gtcatgaagaatgtccagcggaagactcatgctgggaaatacaaagttcagctcagcaat
gttttcggaacagttgatgccacccttgatgtggaaatacaagataaaccagacaaacct
acaggacccattgtgattgaagctctattaaagaactcggtagtgatcagctggaagcca
ccagaagatgacggaggctcctggatcaccaattatgtggtggagaaatgtgaggccaag
gaaggggctgaatggcaattggtgtcttcagccatctcagtgacaacctgtagaattgtg
aacctcacagaaaatgctggctactacttccgggtttcggctcagaacacttttggcatc
agtaaccctctagaggtcccctcagttgtgatcattaagagtccatttgaaaagccaagt
gctcctggcaagccaactatttctgctgtcacgaaagagtcttgtgttgtggcttggaag
ccacctgccagtgatggtggtgcaaagatcagaaattactaccttgagaagcgtgagaag
aagcagaataaatggattgcggtgacaacagaagaaattcgagaaactgtcttctcagtg
caaaaccttattgaaggtcttgaatatgagttccgtgtgaagtgtgaaaacctaggtggg
gaaagcgaatggagtgaaatatcagaacctgtcactcccaaatctgatgtcccgattcag
gcaccacactttaaagaggaactaagaaatctaaacgtcagatatcagagcaatgctact
ttggtctgcaaagtgactggccatccaaaacctattgtgaaatggtacagacaaggcaaa
gaaatcattgctgatggattaaagtacaggattcaagagtttaagggtggctaccatcag
ctcattattgcaagtgtcacggatgacgatgccacagtttaccaagtcagagctaccaac
caagggggatctgtgtctggcactgcctccttggaagtggaagtcccggctaagatacac
ttgcctaaaactcttgagggcatgggagctgttcatgctctccgaggtgaggtgatcagc
atcaagatccctttcagcggcaaaccagatcccgtgatcacctggcagaaaggacaagat
ctcatcgacaataacggccactaccaagttattgtcacaaggtctttcacatcacttgtt
ttccccaatggagtagagagaaaagatgctggtttctatgtggtctgtgctaaaaacagg
tttggaattgatcagaagaccgttgaactggaggtggctgatgttcctgacccacccaga
ggagtcaaagttagtgacgtcgcacgagattctgtcaacttaacctggactgagccagct
actgacggtggcagcaaaatcaccaactacattattgaaaaatgtgcaacgactgcagaa
agatggctccgtgtaggacaggcccgagaaacacgttatacagtgatcaacttatttgga
aaaacaagttaccagttccgtgtaatagcggaaaataaatttggcctgagcaagccttct
gaaccttcagaaccaaccgtaaccaaagaagataagaccagagctatgaactatgatgaa
gaggtagatgaaaccatggaagtttccatgactaaagcatctcattcttcaaccaaggaa
ctctatgagaaatatatgattgctgaagatcttggacgtggtcagtttggaattgtccac
cgttgtgttgaaacatcctcaaaaaagacatacatggctaaatttgtgaaggtcaaaggg
accgatcaggttttggtaaagaaggaaatttccattctaaatattgctaggcacagaaac
atcttatacctccacgaatcatttgaaagcatggaagaattagttatgatctttgagttc
atatcaggacttgacatatttgaacgcattaacaccagtgcttttgaacttactgaaaga
gaaattgtaagttatgttcgccaggtctgcgaagctcttgagttcttacatagtcagagt
attggacactttgacattagacccgaaaatatcatttaccaaacaagacgaagctccgtc
attaaaatcatagaatttggtcaagcccgtcagctgaagccaggggacaacttcaggctt
ctgttcactgcccctgagtactatgcacctgaagtccaccagcatgatgttgtcagcacc
gccacagacatgtggtcacttggaacactggtatatgtgctgttgagtggtatcaatcca
ttcctggctgagactaaccaacagatgattgagaacatcaggaatcccgaatatactttt
gatgaggaggcattcaaagagatcagcctcgaagccatggattttgttgaccggctgtta
gtgaaagagagaaaatctcgcatgacagcatctgaagcgctccagcacccatggctgaag
cagaagacagaaagagtcagtactaaagttatcaggacattaaaacaccggcggtactac
cacactctgatcaagaaagacctcaacatggttgtgtcagcagcccgaatctcctgtggt
ggtgcaattcgatctcaaaagggagtgagcgttgctaaagttaaagtggcatccattgaa
attggcccaatttctgggcagataatgcatgcagttggcgaagaaggaggatatgtcaag
tatgtctgcaaaattgaaaattatgaccagtctacccaagtgacctggtactttggtgtc
agacagctggagaacagtgagaaatacgaaatcacctatgaagatggagtggctaccatg
tacatcaaagacattaccaaattcgacgacggcacctacagatgcaaagtagtcaatgac
tacggtgaagacagttcctatgcagagctgtttgttaaaggtgtgagggaagtttatgac
tattacttccgtagaaccatgaagaaaatgaagcgcagaacagataccatgagactcctg
gaaaggccaccagagtttaccctgcctctctttaacaagacagcttatgtgggtgaaaac
gtccgatttggagtaactattactgtccacccagagcctcgtgtaacatggtataaatca
ggtcagaaaatcaaaccaggtgatgatgacaagaaatacacattcgagtctgacaagggt
ctttaccaattaacaatcaacagtgtaacaacagatgatgatgctgaatatgctattgtg
gcaagaaacaaatacggtgaagacagctgtaaagcaaaactgactgtaaccccacaccca
cctccagcagatacaaccttaagacccatgttcaaaaggctactggcaaatgcagaatgc
caagaaggccagagtgtcagctttgagatcagagtttctggcatccccccgccaacatta
aaatgggagaaagatggtcagcccctgtcccttgggcctaccattgaaattatccacgaa
ggcttggattattatgctttgcacatccgggatactttgcctgaagacactggttattat
agggtcacagccacaaacacagctggatccaccagctgccaggctcacctacaagtggag
cgcttgaggtacgtcaaacaagaattcaagagtaaagaggagcgtgaaagacacgtacag
aagcaaatcgacaagacaataagaatggctgaaattctttctggaacggaatctgtgcca
ctgacacaggtagcccaagaggctctgagagaagctgccatcctctacaagccagctgta
agcaccaagaccgtaaagggggaattccgacttgagaccgaagaaaagaaagaggagaga
aaactccggatgccctatgaagtaccagagccacgtaagcacaagcggaccgtcatagaa
gaagatcaacgcattaaacagtttgtgcctatgtctgacatgaaatggtacaaaaagata
cgtgatcaatttgaaatgccggggaaaattgacagaattgtacagaaaagacaaaagcgc
atccgcctttcaagatgggaacagttctatgtgacgcctcttccacgctttacggatcaa
tacaaacccagatggcgcattcccaaattgacccaagatgaccttgaaatagtgaggcca
gcccgccggcgtacaccttctcctgactacgccttctactacagacctagaagacgttcc
cttggtgacatctcagatgaagaattactccttcccattgatgactacttggcgatgaaa
agaacggaggaagagaggctgcgtcttgaagaggagcttgaattgggtttttcagcttca
cccccaagccggagccctccacgttttgagctttctagtctgcgttactcttccccacag
gctcatatcaagatggaggaaacaagaaaagacttcagatactcaacctatcacatccca
accaaggctgacactagtacaagttatgcagaactgcgggagcggcacgcccaggcctcc
tacaggcagcccaaacaacggcagcgaatcatggctgagaaggaggacgaagagttgctt
cgtccggttacaaccacccatcgtctctcagaatacaaaagcgagcttgaccacatgtca
aaggaacaaaagtctagaaagaaatcaaagcaacagagaagagtgacagaaatcacagaa
attgaggaagaatacgaaatcacaaaacgtgctcaaagagagtcatcctcatctgtgtct
agacttctgagacgacggcgctccctgtctccaacttatattgagttaatgaggccggtg
tctgaactgatccgatcacatccacaaccagctgaggaatacgaagatgacacagagaga
aggtctcccactccagagagaactcgcccacgttcccccagccccgtctctagtgagaga
tcactctcaagatttgagaggtcagcaagatttgatatcttttccaggtatgagtccatg
aaggcagctttaaagactcagaagacatcagaaaggaagtatgaagttttgagtcagcag
ccttttactctggaccatgcccctcggattacactgagaatgcgctcccacagggtaccc
tgtggccagaatacccggtttatcctaaacgttcagtctaagccaactgctgaggttaaa
tggtaccataatggtgtagaactccaagagagcagtaagattcattacaccaacatgagt
ggggtcctgaccctggaaattctagactgtcatattgatgacagcggaacatatcgcgcc
gtgtgcaccaactacaaaggtgaagcttctgactacgcgaccttggatgtaacaggaggg
gattataccacctacgcttcccggcgcagagatgaggacgtcccccggtcccttttccct
gacttgaccaaaacagaggcatatgcggtttcatcgttcaagagaacatctgagatggaa
gcctcttcttcagtcagggaaatgaagtcgcagatgacagagacaagggaaagtctctca
tcatatgaacaccacgcatctgcagaaatgaaaagggctgcagtagaagaaaagtcgctg
gaagaaaaatccacacacagaaagatcaagtccactttggaagcaagaatcctaaccaag
ccaaggtccataactgtctctgagggagagtctgcaaggttttcttgcgacaccgatggt
gagccagtaccaactgtgacctggctgcgtggaggacaagtgatcagtacttccacccgc
caccaagtgaccaccacaaaatacaagtccacctttgagatctcttcagtccaggcttct
gatgagggcaactacagcgtggtggtagaaaacagtgaagggaggcaagaagcacagttc
actctgactattcagaagtccagagttactgaaaaggctgtgacttcaccaccgaaggtc
aaatccccagagcctcaggtgaaatccccagaaggagttaagtctccaaaacgagtgaaa
tccccagaactggtaacttctcccccaaaagccgtatcacccacagagaaaaaacccaca
gcaacagagaaagttgggcagctaccagtctctgccccacccaagatatctcagtccctg
aaagcagaagctgttaaagacatcgcaaagctgacctgtgcagttgaaagcagtgtatta
tgtgcaaaagaggtcgcctggtataaagatggcaagaaactgaaggaaaatgggcatttc
cagtttcattattcagcagatggtacctatgagctcaaaatccataacctcactgaatct
gattgcggagaatacgtttgtgaaatttctggggaaggtggaacttccaaaactaactta
caattcatgggacaagcctttaagagcatccacgagcaggtgtcgagcgtattggaaact
aagaaatcagctcagaaaactgccgagtcaacagaaaccaaggtatcagctcagaaaact
gccgagtcaacagaaaccaaggtatcagctcagaaaactgccgagtcaacagaaaccaag
gtatcagctcagaaaactgccgagtcaacagaaaccaaggtatcagctcagaaaactgcc
gagtcaacagaaaccaaggtatcagctcagaaaactgccgagtcaacagaaaccaaggta
tcagctcagaaaactgctgagtcaacagaagccaaggtatcagctcagaaaactgctgag
tcaacagaaaccaaggtatcagctcagaaaactgctgagtcaacagaaaccaagaaaacg
gaaacaaaagctcctgagccaatatcctcaaagccagtaattgttactgggctgcaggat
acaactgtctcttcagacagcatcgctaaattttccattaaagttactggagaaccccag
ccgactgtcatctggacaaaggatggaaaggctattacacagggaggtaaatataaactc
tctgaagacaaaggaggattcttcttagaaattcttaagactgacacttctgacagcggg
ctttacacttgcacagtaacgaactcagctggatctgtgtcctcgagctgcaaattaacc
ataaaagctgtaaaagacactgagacacagaaagtatctacacaaaagacttccgaaatc
acatcccagaaggccgttgtccaagaggaaatttcccagaaagccttaatctctgaagaa
atcaagaagtcagaggtgaaatctcaagaaaagttagccctcacggaggaagcttcaaag
gttacaatttctgaaaaagtcaagaagtcagaagccgcctccctggaaaaatccattgtc
catgaagaagtcaccaaaacttcccaggcaatggaagaaatcagcactcaagttgaaatt
aaagccttttctagtcagatgagcataactgatggtcagaaagtgactttaaaagccaac
attgctggtgccactgatgtgaaatgggtgctaaatggagtagagctcactaactccgag
gagtacagatacggcgtctcgggcagtgatcagaccctaaccatcaagaaggccagtcac
caacaccaaggaatcctcacctgcattggcaaaaccagtcaaggaatcgtcaagtgtcag
tacgacttgagcctgagcgaagagctctcagatgctccggccttcatctcacagcccaga
tctcaaaatgttaacgaaggacaaagcgttctcttttcttgtgaaatcagtggtgagccc
tctcctgaaatcgaatggtttaaaaacaacctgccggtttctgtttcttcaaatatcagc
gtcagtcgctccagaaatgtatattctcttgaaatccgaaatgcgtcagtaagtgacagt
gggaagtacaccattaaggccaaaaatttccgtggccaatgttcagctactgcttcctta
acggtccttcctctagtggaagaacctcccagagaggtagtattgaagacaagcgatgac
acgagcttgcaaggaagcttctcgtctcagtccgtccaaatgtccgcgtctaagcaggag
gcctccttcagcagtttcagcagcagcagtgctagcagcatgactgaaatgaaatttgca
agcatgtctgcccaaagcatgtcctccatgcaagagtcctttgtaggaatgagttccagc
agttttatgggacaatctagtatgacacaactggcgagctcgagtagtaaaatgcttaaa
gcaggcataagaggaattccacctaaaattgaagctcttccctctgacatcagcattgat
gagggcaaagttctaacagtagcctgtgcttttactggtgagcctacgccagaaataaca
tggtcgtgtggtggaagagaaatccaaaatgaagaccaggggagattccacattgaaaac
acagaggacctgaccactctgatcatcatggacgtacagaaacaagacggtggactttat
accctgagcttagggaatgaatttggatgtgactccgctactgtgaatataaatattcga
tccatttaa

DBGET integrated database retrieval system