KEGG   Myotis davidii: 102766590Help
Entry
102766590         CDS       T02992                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
myd  Myotis davidii
Pathway
myd04010  MAPK signaling pathway
myd04014  Ras signaling pathway
myd04015  Rap1 signaling pathway
myd04022  cGMP-PKG signaling pathway
myd04066  HIF-1 signaling pathway
myd04068  FoxO signaling pathway
myd04072  Phospholipase D signaling pathway
myd04150  mTOR signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04152  AMPK signaling pathway
myd04211  Longevity regulating pathway
myd04213  Longevity regulating pathway - multiple species
myd04520  Adherens junction
myd04910  Insulin signaling pathway
myd04913  Ovarian steroidogenesis
myd04923  Regulation of lipolysis in adipocytes
myd04930  Type II diabetes mellitus
myd04931  Insulin resistance
myd04932  Non-alcoholic fatty liver disease (NAFLD)
myd04960  Aldosterone-regulated sodium reabsorption
Module
myd_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102766590 (INSR)
   04015 Rap1 signaling pathway
    102766590 (INSR)
   04010 MAPK signaling pathway
    102766590 (INSR)
   04066 HIF-1 signaling pathway
    102766590 (INSR)
   04068 FoxO signaling pathway
    102766590 (INSR)
   04072 Phospholipase D signaling pathway
    102766590 (INSR)
   04022 cGMP - PKG signaling pathway
    102766590 (INSR)
   04151 PI3K-Akt signaling pathway
    102766590 (INSR)
   04152 AMPK signaling pathway
    102766590 (INSR)
   04150 mTOR signaling pathway
    102766590 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102766590 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102766590 (INSR)
   04923 Regulation of lipolysis in adipocyte
    102766590 (INSR)
   04913 Ovarian Steroidogenesis
    102766590 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102766590 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102766590 (INSR)
   04213 Longevity regulating pathway - multiple species
    102766590 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102766590 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102766590 (INSR)
   04931 Insulin resistance
    102766590 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myd01001]
    102766590 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:myd04090]
    102766590 (INSR)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102766590 (INSR)
Protein kinases [BR:myd01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102766590 (INSR)
CD molecules [BR:myd04090]
 Proteins
  102766590 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like
Motif
Other DBs
NCBI-GeneID: 102766590
NCBI-ProteinID: XP_006775438
Position
Un
AA seq 1386 aa AA seqDB search
MYGRGFSQGQDPLSDAPPLILKTHHCVLAHLSHFLHIFTLVCPSMDIRNNFTRLHELANC
SIIEGHLQILLMFRTRPEDFRDLSFPKLVMITDYLLLFRVYGLESLKDLFPNLTVIRGSR
LFFNYALVIFEMVHLKELGLYSLMNITRGAVRIEKNNDLCYLATIDWSRILDSVEDNYIV
LNKDDNEECGDICPGTAKGKTSCPATVINGQFVERCWTHSHCQKVCPTSCKSHGCTAEGL
CCHPECLGSCSEPNDPTKCVACRHFYLDGRCVETCPAPYYHFRDWRCVNFSFCLDLHNKC
KNSRRQGCHQYVIHNNKCFGGPVCPDPLPFFLLSLMCTPCLGPCPKVCHILEGEKTIDSV
TAAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRK
LRLIQGNTLEVGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEE
ISGTKGRQERTDIALKTNGDQASCENELLKFSYIRTSYDKIMLKWEPYWPPDFRDLLGFM
LFYKEAPYRNVTEFDGQDACGSNSWTVVDIDPPPRSTDPKLQNHPGWLMRSLKPWTQYAI
FVKTLVTFSDERRTYGAKSDIIYIQTNATNPSVPLDPISVSNSSSQIILKWKPPSDPNGN
ITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPSELDGSQKHNQSEYDEAAGECCS
CPKTDSQIQKELEESSFRKTFENYLHNVVFVPRTISSGPGAEDSRSSRKRRALGDEGNVT
MAVPTAPGFPNTSTIVPTSSEEPRPFEKVVNKESLVISGLRHFTGYRIELQACNQDFPEE
RCSVAAYISARTMPEAKADDIVGPVTHEIFENNIVHLMWQEPKHPNGLIVLYEVSYRRYG
DEELHLCVSRRHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEATYFYVTNYLDVPS
NIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQSDGPVGPLYASSNPEYLSASDVFPCSVYV
PDEWEVPREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASMRERIEFL
NEASVMKGFACHHVVRLLGVVSKGQPTLVVMELMTHGDLKSHLRSLRPDAENNPGRPPPT
LQEMFQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRK
GGKGLLPVRWMAPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDG
GYLDIPDNCPERLSELMSMCWHFNPKMRPTFLEVVDLLKDNLHPSFPEVSFFYSEENKAP
ENDELEMEFEDMESVPLDRSSHCQREEDGGCSLALKRNYEDHMSYSHMNGGKKNGRVLTL
PRSSPS
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaggggatttagccaagggcaggaccctctgagcgatgccccgccgctaatt
cttaaaacccaccattgtgtgttagctcacctgtcacactttctgcatatttttactcta
gtgtgtcccagcatggacatccggaacaacttcacgaggctgcacgagctggctaactgc
tcgatcatcgaaggacatttgcagatactgttgatgttcagaacaaggcctgaggatttc
cgagacctcagtttccccaaactcgtcatgatcactgattacttgctgctgtttcgggtc
tatgggctggagagcctgaaggacctattccccaacctcacggtcatccggggctcccgc
ctcttcttcaactacgcgctggtcatcttcgagatggtccacctgaaggagctgggcctg
tacagcctgatgaacatcacccggggggctgtccgcatcgagaagaacaacgacctctgc
tacctggctaccatcgactggtcgcgcatcctggactcggtggaggataattacatcgtg
ctgaacaaagacgacaatgaagagtgtggggacatctgtccaggcactgcgaagggcaag
accagctgccctgccaccgtcatcaacgggcagtttgtcgaacggtgttggactcacagc
cattgccagaaagtctgcccgaccagctgcaagtcgcacggctgcactgctgaaggcctc
tgctgccaccccgagtgcctgggcagctgctccgagcccaacgaccctaccaagtgcgtg
gcctgccgccacttctacctggacgggaggtgcgtggagacctgcccagccccgtactac
cacttccgggactggcgctgtgtgaacttcagcttctgcctggacctgcacaacaaatgc
aagaactcgcggcggcagggctgccatcagtacgtcattcacaacaacaagtgctttggg
ggtcctgtgtgccctgaccctcttcctttctttttactcagcttgatgtgcactccgtgt
ctgggcccctgtcccaaggtctgtcacatcctggaaggtgagaagaccatcgactcagtg
acagctgcccaggagcttcgagggtgcaccgtcatcaacgggagcctcatcatcaacatc
cgtgggggcaacaacctggcagctgagctcgaggccaacctcggcctcattgaggaaatc
tcagggtatctgaaaatccgccgttcctacgcgctagtgtcactttccttcttccggaag
ttacgtctgattcaggggaataccttggaagtcgggaactactctttctatgccttggac
aaccagaacctaaggcagctatgggactggagcaaacacaacctcaccataactcagggg
aaactcttcttccactataatcccaaactctgcttgtcggaaattcacaagatggaagaa
atttcaggaaccaagggacgccaggagaggaccgacattgccctgaagactaatggggac
caggcgtcctgtgaaaatgaattacttaaattttcttacatccggacatcttatgacaag
atcatgctgaaatgggagccgtactggccccctgacttccgagacctcctggggttcatg
ctcttctacaaagaggccccttaccggaacgtgacggagtttgatgggcaggatgcgtgt
ggatccaacagctggacggtggtggacattgacccgcctccgaggtccactgaccccaag
ttacagaaccatcctgggtggctgatgcggagcctcaagccctggactcagtatgccatc
ttcgtgaagaccttggtcaccttttctgatgaacgccgcacatatggggccaagagcgat
atcatctatatccagacaaatgccaccaatccttccgtccccttggatcccatctcggtt
tctaactcttcatcccagattatcttgaagtggaagcctccctccgaccccaacggcaac
atcacacactacctggttttctgggagaggcaggcggaagacagtgagctgtatgagctg
gattattgcctcaaagggttgaagctgccctcccggacctggtccccaccatctgagttg
gatggttcccagaagcacaaccagagcgagtacgacgaggctgccggcgagtgctgctcc
tgcccgaagactgactctcagattcagaaggaactggaggagtcctcgttcaggaagact
tttgagaattacctgcacaatgtggtcttcgtccccagaacaatctcttcaggccctggt
gctgaggacagtaggtcgtcgagaaaacgcagggcccttggtgacgagggtaacgtgacg
atggctgtgcccacagctccgggtttccccaacacctcaaccatcgtgcccacaagctcg
gaggagccgcggcccttcgagaaagtggtgaacaaggagtcgctggtcatctcgggcctg
cgccacttcactggctaccgcatcgagctgcaggcttgcaaccaggatttccccgaggag
aggtgcagcgtggccgcctacatcagcgccaggaccatgcccgaagccaaggcagatgac
attgttggccccgtgacccatgaaatcttcgagaacaacatcgttcatttaatgtggcag
gagccaaagcacccgaacggtctgattgtgctgtatgaagtgagctatcggcgatacgga
gatgaggagctgcacctgtgtgtgtcccgcaggcacttcgccctggagcggggctgccgg
ctgcgcgggctgtcacccgggaattacagcgtgagagtccgggccacctccctggcgggc
aatggttcctggacagaagccacctatttctatgtgacaaactacttagacgtcccctcc
aatattgcaaaaatcatcatcggccccctcatctttgtcttcctcttcagtgttgtgatt
ggaagtatttacctattcctgaggaagaggcagtcagacgggccggtgggaccactctat
gcttcttcaaaccccgagtacctcagtgccagcgatgtgttcccatgttctgtgtatgtg
ccggacgagtgggaggtgccacgggagaagatcaccctcctgcgagagctggggcagggc
tccttcggcatggtgtacgagggcaacgccaaggacatcatcaagggcgaggcggagact
cgagtggcggtgaagacggtcaacgagtcggccagcatgcgggagcggatcgagtttctc
aacgaggcctccgtcatgaaaggcttcgcctgccatcacgtggtccgcctcctcggagtg
gtgtccaaaggccagcccacgctggtggtgatggagctcatgacgcacggagacctgaag
agccacctgcgctccctgcggcctgacgctgagaataaccccggccggcctcccccgacc
ctgcaagagatgtttcagatggcagcggagattgctgacgggatggcatacctgaacgcc
aagaagtttgtgcaccgggacctcgcagctcgaaactgcatggtcgcccacgattttacc
gtcaaaattggagactttggaatgaccagagacatctacgaaacggattattaccggaaa
ggtggcaaaggtctgcttcctgtgaggtggatggcacctgaatctttgaaggacggggtc
tttaccgcttcttccgacatgtggtccttcggtgtggtcctttgggaaatcaccagcttg
gcagaacagccttaccaaggcctctctaatgagcaggtgttgaaattcgttatggatgga
gggtatctggatatccccgacaattgtccagagagactcagtgagttaatgagcatgtgc
tggcacttcaaccccaagatgaggccgaccttcctggaggtggttgacctgcttaaggac
aacctgcaccccagctttccggaagtttccttcttctacagcgaggagaacaaggcacct
gagaacgatgagttggagatggagtttgaggacatggagagtgtacccctggatcggtcc
tcacactgtcagagggaggaggatgggggctgttcgctggccctaaagcggaattacgag
gatcacatgtcctacagccacatgaatgggggcaagaaaaacggacgcgtcctgactctg
ccacggtccagtccttcctaa

DBGET integrated database retrieval system