KEGG   Myotis davidii: 102766950
Entry
102766950         CDS       T02992                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
myd  Myotis davidii
Pathway
myd00230  Purine metabolism
myd00240  Pyrimidine metabolism
myd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102766950 (DCK)
   00240 Pyrimidine metabolism
    102766950 (DCK)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102766950 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_33 AAA_28 CoaE AAA_17
Other DBs
NCBI-GeneID: 102766950
NCBI-ProteinID: XP_006769973
Position
Un
AA seq 260 aa
MATPPKRSCPSPATSSEGTRIKKISIEGNIAAGKSTFVNILKQVCQDCEVVPEPIARWCN
VQSTQDEFQELTTSQKSGGNVLQMMYEKPERWSFTFQAYACLSRIRAQLASLNGKIKDAE
KPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
SPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHDSWLLHRTLKTNFDYLQEVPILILDVNE
DFKDKHDSLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagaggagctgcccctctcctgcgaccagctcggagggaacccgc
atcaagaaaatttccatcgaagggaacatcgctgcagggaagtcaacatttgtgaatatc
cttaaacaagtctgccaggattgtgaagtggttcctgaacctattgccagatggtgcaat
gttcaaagtactcaagatgaatttcaggaactgaccacatctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaaacctgagcgatggtcttttaccttccaggcatatgcc
tgcctcagtcgcatacgagctcagcttgcctctctcaacggcaagatcaaagatgcggag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcttctaat
ttatatgaatctgaatgtatgaatgaaacagagtggacaatttatcaggactggcatgac
tggatgaataaccaatttggccaaagccttgaactggatggaatcatttatcttcgagct
agtccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaaacttcactacaagcatgatagctggctcctgcacagaaca
ctgaaaaccaactttgattatctacaagaagtgcctatcttaatattggatgttaatgaa
gactttaaagacaaacacgacagtctggttgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system