KEGG   Myotis davidii: 102767386
Entry
102767386         CDS       T02992                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myd03000]
    102767386 (AHRR)
Transcription factors [BR:myd03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102767386 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 102767386
NCBI-ProteinID: XP_006762512
Position
Un
AA seq 707 aa
MIPPGECMYAGRKRRKPVQKQKPSVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDVVSK
LDKLSVLRLSVSYLRVKSFFQAVQEKCPRQPVAGAPSPEESGPCGGSAVLEGRLLLESLD
GFALVVSAEGVIFYASATIADYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VCGQPLRSETGEDIMLGRLLRAQEGGAGPTEYSAFLTRCFVCRVRCLLDSTSGFLTMQFQ
GKLKFLFGQKRKAPSGTAQSPRLSLFCVVVPVLLPSVAEMKMKGAFLRAKHRADGSTAMD
AKAKATRSLCVSELHGKPNYLAGRNSGENGISVFRAQMDTCRWGRVPARATCLCLRGGPD
LVLYPEGAAGDWGGEEHGRVPSGGSGVRRRREAHAYDCCFETPGPMRQLSWTAGQHGQNG
PKPKLEPSRSDPFPVHATSRGSCMPYPSAPGTIPAFRNSPGAHQAPSAYASRPSRALQDG
EQGLVHSPASGPFPLESLENQVPPPGVQCLAVGGYAAQDIKLPGVPMSPEAPCNPMLSLN
VPIKMESDSGSEDAADGYSVSPSQVWLGASDVAKRQLVTFPTRMHLKTEPDSKHHLYAPH
LGPGMLGAPPRPGRELAPFHPAHFVCLERGHGPPEPEPPPCLCVRGHRPPTLGCDCRAPG
TTPMIKLEPLDSPPWAAHSQDGAPRMLPKSALATLVPPKASECSFLP
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgatcccgccgggcgagtgcatgtacgcagggaggaagagaaggaagcccgtccagaaa
cagaagccttctgtgggggctgagaagtcaaacccttccaagcggcaccgcgaccgcctc
aacgccgagctggaccacctggccagcctgctgccctttccaccagatgttgtctccaag
ctggacaagctctcggtcctgcgtctcagcgtcagttacctcagggtgaagagcttcttc
caagccgtgcaggagaagtgcccgcgccagccagtggccggtgccccctcgccagaagag
agtggtccttgtggagggtccgcagtgctggagggaaggctcctgctggagtctctggac
ggctttgctctggtggtgagtgcggaaggggtgatattttatgcatcagcaacgatcgcg
gactacctgggcttccaccagacagacgtgatgcaccagaacatttatgactacatccac
gtggacgaccgccaggacttctgccggcagctccactgggccatggaccctccccaggtg
gtgtgtgggcagcccctgcgttcggagacaggagaggatatcatgctggggaggctgctc
cgggcccaggaggggggcgccggccccaccgagtactcggccttcctgacgcgctgcttc
gtctgccgcgtgcgctgcctgctggacagcacctcggggttcctgacgatgcagtttcaa
ggaaaactgaaattcctgtttggccagaagaggaaggcgccgtcgggaacagcccagtcc
cctcggctctcgctgttctgcgtcgtggtgcccgtgctcctcccttctgtggcagagatg
aaaatgaagggcgcgtttctgcgggcgaagcacagggcagacggctccaccgcaatggat
gcgaaagcaaaagccaccaggagtctgtgtgtatcagaattgcacgggaaacccaattac
ttagcaggaagaaacagtggagaaaacggcatttctgtgttcagggcacagatggacacc
tgccgctggggccgggttcccgccagggccacgtgcctgtgcctgcggggtggccccgac
cttgtcctgtaccccgagggggccgccggggactggggaggtgaggagcatgggagggtg
cccagcggcggctccggggtcaggaggaggagggaagcacacgcttacgactgctgcttc
gagacgccaggacccatgaggcaactgagctggacggcaggccaacacggtcagaacggc
cccaagccaaagctggagcccagcaggagtgacccgttccctgtgcatgccacctcccgg
ggctcctgcatgccctaccccagcgccccgggcaccatccctgccttccggaattcccct
ggtgctcaccaggcccccagtgcctatgccagccggccgagcagagccttgcaggatggc
gagcagggcctggtccactctcctgccagcggccccttccccctggagagcctggagaac
caggtccctccgccgggagtgcagtgcctcgcagtggggggctatgccgcccaggacatc
aagttgccaggtgtgcccatgtccccggaggccccgtgcaaccccatgctgtcacttaac
gtgcccatcaagatggaaagtgactctggttccgaggatgcagcagatggctactctgtg
tcgccaagccaggtgtggctgggagccagcgacgtggctaagagacagctggtcacgttc
cctaccaggatgcacctgaaaacagagccagactccaagcaccacctgtacgccccgcac
ctggggcctggcatgctgggggctccccccaggcctggcagggagctggcccccttccac
cccgcacactttgtctgcctggagcgtgggcacggccctcctgagccagagcctcccccc
tgcctctgtgtgcggggccaccggccccccactctgggctgtgactgcagagctccaggg
accacacccatgatcaaacttgagcccttggactcacccccatgggccgctcacagccag
gatggggcgcccaggatgctccccaaaagtgccttggcaacactggtgccgcccaaagcc
tccgagtgctcttttctgccatga

DBGET integrated database retrieval system