KEGG   Myotis davidii: 102767539Help
Entry
102767539         CDS       T02992                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
myd  Myotis davidii
Pathway
myd03013  RNA transport
Brite
KEGG Orthology (KO) [BR:myd00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102767539 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:myd03012]
    102767539 (EIF3A)
Translation factors [BR:myd03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102767539 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 102767539
NCBI-ProteinID: XP_015427951
Position
Un
AA seq 1367 aa AA seqDB search
FPEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQY
KNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSG
EDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEF
RKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVE
DIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQEE
MQRXXXXXXXXXXXIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDM
VRFNVLQYVVSEVKDLYNWLEVEFNPLKLCERVTKVLNWVKDQPEKEPELQQYVPQLQNN
TILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFG
SDLNYATREDAPLGPYLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAV
TAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQ
EAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQV
EQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERIT
TMQLEREKALEHKNRMSRMLEDRDLFEMRLKAARQSVYEEKLKQFEERLAEERHNRLEER
KRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEELREYQERVKKLEEV
ERKKRQRELEIEERERRREEERRLGEDPLSRKDSRWGDRDSEGTWRKAPEVDSEWRRGPP
EKEWRRGEGRDEERPIRRDEDRPRRLGEDEERESSLRLEDDRIPRRGMDDDRAPRRGPDE
DRFPRRGADDDRPSWRNADDDRPPRRIGDRPPRRLGDDDRPPRRIGDDDRPPRRIGDDDR
GSWRHMDDDRPPRRGLDEDRGNWRAADEDRGPRRGMDEDRGPRRGGADDERSSWRNADDD
RGPRRGLDDDRGPRRGLDEDRGPWRNADDDRIPRRGTDDDRGPWRNMDDDRISRRADDDR
IPSRRGEDSRPGLWRPFVKPGGWREKEKAREESWGPPRESKPPEEREWDREKERERESQD
REENDKDPERERDRERDGDREDRFRRPRDEGDWRRGPAEEASSWRDSGRRDDRDRDDRPR
VRDDRRDLRERRDDRDRRGPPIRSEREYRCLVSSWRRADDRKDDRAEERDVPRRVPPPAL
SRERERDRDREREGEKEKASWRAEKDKESLRRTKNETDEDGWTTVRR
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
tttccagaatttcttgaggttggcaaaaagcaacctgctttggatgttctttatgatgtt
atgaaaagtaagaaacatagaacatggcaaaaaatacatgaaccaatcatgttgaaatac
ttggaactttgtgtggatcttcgaaagagccatttggctaaagaaggattataccagtat
aagaacatttgtcaacaggtgaacatcaaatctctagaggatgttgttagggcatatttg
aaattggcagaggaaaaaactgaagctgctaaagaagaatcccagcagatggtcttagac
atagaagatctggataatattcaaactcctgagagtgttctcctaagtgctgtaagtggc
gaagacactcaggatcgtactgacaggttacttttaactccatgggttaaattcctgtgg
gaatcatacagacagtgtttggaccttcttcgaaacaattctagagtagagcgtctctac
catgatattgcccaacaagctttcaaattctgcctccaatacacccgtaaggccgaattc
cgtaagctgtgtgacaatttgagaatgcacttgtctcagattcaacgccaccacaatcag
agtacagcaatcaatcttaataatccagagagccagtctatgcatttggagaccaggctt
gttcagttggacagtgctatcagcatggagttgtggcaggaagcattcaaagctgtggaa
gatattcacgggctattctccttatctaaaaagccacctaaacctcagttgatggcaaat
tactataacaaagtctcaactgtcttttggaaatcgggaaatgctctttttcatgcatct
acactccatcgtctttaccatctatctagagaaatgagaaagaatcttacccaagaagag
atgcaaaggnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncatccctattacccctgaa
cgtactgatattgctcgacttctggatatggatggtatcatagttgaaaaacaacggcgc
cttgcaacactgctaggtcttcaagccccaccaacgcgaattggcctcattaacgatatg
gttagattcaatgtactacagtatgttgtctcagaagtgaaagacctttacaattggctg
gaagtagaatttaaccccctaaaactctgtgagagagtcacaaaggttctaaattgggtt
aaggaccagcctgaaaaggaaccagagctgcaacagtatgtcccacagctgcaaaacaac
accatactccgtcttctgcagcaggtggcacaaatttatcagagcattgagttttctcgt
ttgacttctctggttccttttgttgatgctttccaactggaacgtgccattgtagatgca
gccaggcactgtgacctgcaggttcgtattgaccacacttctcggacccttagttttgga
tctgatttgaattatgctactcgagaagatgctccacttggtccttatttgcaaagcatg
ccttcggagcagataagaaaccagctgacagccatgtcctcagtactcgcaaaagcactt
gaagtcattaaaccagctcatatactgcaagagaaagaagaacaacatcagttggctgtt
actgcataccttaaaaattcgcggaaagagcatcagcgtatcctggctcgacgtcagaca
attgaggaaaggaaagagcggcttgagagtctgaatattcagcgtgagaaagaagaattg
gagcagagggaagctgaactccagaaagtacggaaggctgaagaagagaggctgagacag
gaggcaaaggagagagagaaggaacgtatcttacaggaacatgaacaaatcaaaaagaaa
actgttcgtgagcggctggagcagatcaagaaaacagaactgggtgccaaagcattcaaa
gatatcgatattgaagatcttgaagaactggatccagatttcatcatggctaagcaggtt
gaacaactagagaaagaaaagaaggaacttcaggaacgcttgaagaatcaagaaaagaag
attgattattttgaaagagctaaacgcttggaagaaatccctttaataaaaagtgcttat
gaagaacagagaattaaagacatggatctgtgggaacaacaagaagaagaaagaattact
actatgcagctagaacgggaaaaggctcttgaacacaagaatcgaatgtcacgaatgctt
gaagacagagatttatttgaaatgcgactcaaggcagcacgacaatctgtttatgaggaa
aaacttaaacagtttgaagagcgattagcagaagaaaggcataatcgcttggaagaacgt
aaaaggcaacgtaaagaagaacgcagaataacctactatagagaaaaggaagaggaagag
cagaggagggcagaagagcaaatgctaaaagagcgtgaagagagagaacgtgcagaacgg
gcaaaacgtgaggaagagcttcgagaatatcaggagcgggtcaagaagttagaagaagta
gaaaggaaaaaacgccaaagggagttggaaattgaagaaagggagcgtcgtagagaggaa
gagagaagacttggtgaagatccactttctagaaaggactctcgatggggagatagagat
tcagaaggcacgtggagaaaagcacctgaagtagattctgagtggagaagaggcccacca
gagaaggagtggagacgtggagaagggcgagatgaggaaaggcctattagaagagatgaa
gatcgcccaaggcggttgggggaagatgaagagagagagtcttctcttagactagaagat
gatcggattcccaggcggggcatggatgatgacagagccccccgacgtggtcctgatgaa
gataggttccctcgccgtggggcagatgatgatcggccttcctggcgcaatgcagatgat
gacaggccccccagacgaattggcgacaggcctcccagacgactcggtgatgacgataga
cctcccagacgaattggtgatgacgacaggcctcccagacgaattggtgatgacgacagg
ggaagctggcggcatatggatgatgatagaccacctagacgaggattggatgaggacaga
ggaaattggcgggcagctgatgaggacagaggaccaagacgtggtatggatgaagatcgg
gggccacggcgaggaggtgctgatgatgagcggtcatcctggcgtaatgctgatgacgac
cgaggtccaaggagaggcctggatgatgaccgggggcccaggcgcgggctggatgaagat
cgaggaccttggaggaacgccgatgatgatagaattcccaggcgtgggacagatgatgac
aggggtccttggagaaacatggatgatgaccggatctcaagacgggctgatgatgatcgg
attcccagcagaaggggcgaggactcaagacctggtctctggagaccatttgtcaagcca
ggtggatggagagagaaggaaaaagccagagaagaaagttggggtccacctcgagaatca
aaaccaccagaagaacgtgaatgggacagagaaaaagagagagagagagagagtcaagat
cgtgaagagaatgacaaggatccagagagagagagggacagagagagagatggggatcga
gaggatcgcttcagaagaccgagggatgaaggtgactggagaagagggccagctgaggaa
gcttcaagctggagagattcaggtcgccgtgacgatagggatagagatgaccgcccacgt
gtgagggatgatcgccgagatctaagagaaagacgagatgacagagaccgcagaggaccg
cctatcagatcagagcgtgaatacagatgtttagtgagttcctggagacgtgctgatgac
aggaaagatgaccgggcagaagagcgggatgtccctcgtcgtgttcctcctccagctctt
tcaagagagcgagaaagagatcgagaccgggaaagagaaggtgaaaaggagaaggcctcc
tggagagctgagaaagataaggagtctcttcgtcgtactaaaaatgagactgatgaagat
ggatggactacagtacgacgttaa

DBGET integrated database retrieval system