KEGG   Myotis davidii: 102767691Help
Entry
102767691         CDS       T02992                                 

Gene name
ACVR1C
Definition
(RefSeq) activin A receptor type 1C
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
myd  Myotis davidii
Pathway
myd04060  Cytokine-cytokine receptor interaction
myd04350  TGF-beta signaling pathway
myd04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102767691 (ACVR1C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102767691 (ACVR1C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102767691 (ACVR1C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myd01001]
    102767691 (ACVR1C)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102767691 (ACVR1C)
Protein kinases [BR:myd01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   102767691 (ACVR1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Pkinase_fungal Activin_recp APH
Motif
Other DBs
NCBI-GeneID: 102767691
NCBI-ProteinID: XP_006767447
UniProt: L5LN69
Position
Un
AA seq 444 aa AA seqDB search
MLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLG
PMELTVVITVPVCLLSMAAVLSIWACQGRQCSNRKKKRQNVEEPLSECNLVNAGKTLKDL
IYDVTASGSGSGLPLLVQRTIARTIILQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDER
SWFREAEIYQTVMLRHENVLGFIAADNKDNGTWTQLWLVLEYHEQGSLYDYLNRNIVTVA
GMIRLALSIASGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADFGLAVKHDS
ILNTIDIPQNPKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGI
VEEYQLPYYDMVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGA
ARLTALRIKKTISQLCVKEDCKAQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccaatggaaaagagcaggtgatcaagtcctgtgtctctctcccagaattaaat
gctcaagtcttctgtcatagttccaacaatgttaccaaaaccgaatgctgcttcacagat
ttctgcaataacataacactgcaccttccaacagcctcaccaaatgcccccaaactcgga
cccatggagctgaccgttgttattactgtgccagtgtgcctgctgtccatggcagcagtg
ctgagcatctgggcatgccaaggtcgacagtgtagcaacaggaaaaaaaagaggcagaat
gtggaggaaccactctctgaatgcaacctggtaaatgctgggaaaactctgaaagatctg
atttatgatgtgaccgcctctggatccggatctgggttacctcttctggttcagagaaca
attgccaggacgattattctccaggagattgtaggaaaaggccgatttggtgaggtctgg
catggaagatggtgtggggaagacgtggctgtgaaaatattctcctccagagatgaaaga
tcctggtttcgtgaggcagaaatttaccagacggtgatgctgagacacgagaatgtcctt
ggtttcattgctgctgacaacaaagataatggaacttggacccaactttggcttgtcttg
gaatatcatgaacagggctccttgtatgactatttgaatagaaacatagtgaccgtggct
gggatgatcagactggcactttccatagctagtggtctggcccaccttcacatggagatt
gttggtacacaaggcaaacctgccattgctcatcgagacataaaatcaaagaatatctta
gtgaaaaaatgtgaaacttgtgccatagcagactttggattagctgtgaagcacgattcc
atactgaacactattgacatacctcagaatcctaaagtgggaaccaaaaggtatatggcc
cctgaaatgcttgatgatacaatgaatgtgaatatctttgagtccttcaaacgcgctgac
atatattctgttggtctggtttactgggaaatagcccgaaggtgttcagttggaggaatt
gttgaggagtaccagttgccttattatgacatggtgccttcagatccctcaatagaggaa
atgaggaaggttgtttgtgatcagaagtttcgaccaagcatcccaaaccagtggcaaagc
tgtgaagcactccgagtcatggggagaataatgcgcgagtgttggtatgccaatggggca
gcccgcctcactgcccttcgtattaagaagactatttctcaactttgtgtcaaagaagac
tgcaaagcccaatga

DBGET integrated database retrieval system