KEGG   Myotis davidii: 102768467Help
Entry
102768467         CDS       T02992                                 

Gene name
NKTR
Definition
(RefSeq) natural killer cell triggering receptor
  KO
K12740  NK-tumor recognition protein
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:myd03110]
    102768467 (NKTR)
Chaperones and folding catalysts [BR:myd03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    102768467 (NKTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase SR-25
Motif
Other DBs
NCBI-GeneID: 102768467
NCBI-ProteinID: XP_006770573
Position
Un
AA seq 1469 aa AA seqDB search
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKS
TKDVFEKKRKKPTHSEDSDSSSSSSSSSESSSESEIERERSRRRKHKRRPKVKHPKRRRK
EASSSEEPRNKHAVSPKGPSERSDNNGERSVDSNAKREKPVVRPEEIPPVPENRFLLRRD
MPLVTVEPEPKIPDATPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST
ARHSDGHHKKRRKDKKVKHKKKAKKQKHCRRHKQTKKRRIIVPSDIESSKSSTRRMKFPC
DRERRSRSSSLSSHHSSKRDWSKSDKGDQSSSTHSSRDSYRSKSHSQSYSRGSSRSRTPS
KSSSHSPSRSKSRSSSKSGHQRTASKSPKRTAPQLSENKPVKTEPLRATVPQSETVLVQQ
PVVAEHIPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLLPIQSTYSLTNIKET
GSSSSYNKREKNSESDQSAYSKYSDRSSESSPRSRSRSSRSRSYSRSYTRSRSVASSHSR
SRSPSSRSHSRNKYSDRSQCSRSSSYSSVSSDAGRRAKRKLRSSGKNSTSHKRQSSSSGK
TPRSKYTKGRDKSSCPRKYSESRSSLDYSSDSEHSGVQVTQSAQEKEKQVQMEMSNKREK
NRDEEKSKPERECPRSKKRTLKENLSDHFRSANKPKRKNYAGSKWDSESNSERDVTKSSK
KNSLPSSDKEEGEATSDSESEFSEIHVKAKPTTKSSASSSLPDGNGAWKSSKQQSSTSDS
EGSCCNSENPRGKPRKHKHASKEALKREHTKKVKEKMKGKKDKKHKAPKRKQAFHWQPPL
EFGEEEEEESNEKQVTQESQEKKQASENSETTKENIPQTEKPCEDSSLSDKQNAVTILSD
TEQPANDESKLSISPTPSATEENVASSPPNIQHIEESVPGRVEDMFQADDNMEICTPDRS
SPAKVEGASPLGNSRLDTPETGIAVKQAEHPAAEVGKQESSVSESPTVREVGKPDSSSTG
SAGAVESTARREAAERGQVSLLDNKWKPLQGVGNLAAPTATSSAVEVKALTAVPEMKPQG
LRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDGDSQSRSPSRSRSKS
ETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSSRSYKSHR
TSSRSRSRSTSYDPHSRSRKELTFFCLIRRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYN
RRSRWVPPQNTARARGHWVCEAVDLGEKA
NT seq 4410 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcaggaccggccgcagtgccactttgacatcgagatcaaccgggagccggtt
ggtcgcattatgtttcagctcttctcagacatatgtccaaaaacatgcaaaaacttcctt
tgcctctgctcaggggagaaaggccttgggaaaacaactgggaagaagttatgttataaa
ggttctacattccatcgtgtggttaaaaactttatgattcagggtggggacttcagtgaa
ggtaatggaaaaggtggagaatcaatttatggtggctattttaaagatgaaaactttatt
ctcaaacatgacagagcgttccttttgtcaatggctaatcgagggaaacataccaatggt
tcccagtttttcattaccacgaaacctgcgccgcacctggatggggtgcatgttgtcttt
ggactagttatttctggttttgaagtaatcgaacaaattgaaaatctgaaaactgatgct
gcaagcagaccttatgcagatgtgcgagttattgactgtggggtgcttgccacaaaatca
acaaaagatgtttttgagaaaaaaaggaagaaaccaactcattcagaagactcggattcc
tcttccagttcctcttcctcttcagaatcatcttcagaaagtgaaattgaacgtgagaga
agcagaagaaggaaacataagaggaggccaaaagttaaacatcctaaaagaagacgaaag
gaagcaagtagctcagaagagccaaggaataaacatgcagtgagtccaaaaggtccctct
gagagaagtgataacaatggggaaaggtcagtggattcaaatgctaaaagggaaaagcct
gtggtccgcccagaagagatacccccagtgcccgagaaccgattcttgctgagaagagat
atgcctcttgtcacagtggaacctgaaccgaagattcctgatgctacacccattgtaagt
gatcagaaaccatctgtgtcaaagtctggacggaagattaaaggaaggggcacaattcgc
tatcacacacctccaaggtcaaggtcctgctctgaatcagatgatgatgacagcagtgag
actcctcctcactggaaagaggagatgcagagactgagagcatacagacctcctagtgga
gaaaagtggagtaaaggagataagttaagtgacccctgttcaagccgatgggatgaaaga
agcttgtcccaaagatcgagatcatggtcttacaatggatattattcagaccttagtaca
gcaagacactctgatggtcaccataaaaaacgcagaaaagacaaaaaagttaaacataaa
aagaaagctaaaaagcaaaaacattgcagaagacacaaacagactaagaagagaaggatt
attgtaccatctgacatagaatcctcaaaatcttctacccgacgaatgaaattcccttgt
gatagagaaaggagatctcgttcttcctcgctatcctctcatcactcatccaagagggac
tggtctaaatctgataagggtgatcagagctcttccacccattccagcagagactcctac
agatccaaatctcactcccagtcttactctagaggaagctcaagatcacggactccatcg
aaatcctcctcacattccccaagtagatcaaagtccagatctagttccaagtcagggcac
caacggacagcatcaaagtcccccaaaagaacagcccctcagctaagtgaaaataaacca
gttaaaacagaacctttaagagcaacagtgccacagagtgaaaccgtcctagtacaacag
ccagtggtggcggaacatattcctgtgataccactgagtgacagtccccctccttccagg
tggaagcctggacagaagccctggaagccctcttatgagcgaattcaggaaatgaaagca
aaaacaacccatttgctacccatccaaagcacttacagtttaacaaatattaaggagact
ggtagttcatcatcctacaataaaagagaaaaaaattcagaaagtgatcagagtgcttat
tcaaaatacagtgatagaagttcagaaagttccccaaggtcaaggagcagatcctctagg
agtaggtcttattccagatcgtacacaaggtcgagaagtgtagcaagttcacactcaagg
tctaggtctccctcatctagatctcattcacgaaataaatacagtgatcgctcacaatgt
agtagatcatcttcatattcttctgttagcagtgatgctggaagacgagcaaagagaaaa
cttagatccagtggaaaaaatagcacttcacataaaaggcagagcagcagctctggaaag
acacctcgcagtaaatataccaaaggcagagacaagtcttcgtgcccgagaaagtatagc
gaaagcaggtcatccttagattattcttcggacagtgaacactcaggtgttcaggtgaca
cagtcagcccaggagaaagagaagcaagtccaaatggaaatgagtaacaaacgagagaaa
aacagagatgaagagaaatccaagcctgaacgggaatgcccgcgttcaaaaaaaagaact
ttgaaagagaatctttctgatcactttagaagtgccaataagcccaaaaggaagaattat
gctgggagtaaatgggactctgagtcgaattccgaacgagacgtaactaagagcagtaaa
aagaattccctgccatcttctgataaggaggaaggtgaggccacatcagattctgagtca
gagtttagtgaaattcacgtcaaagccaaacccacaacaaagtcttcagcaagttcttca
ctgcccgatggtaatggtgcttggaagtcaagcaaacagcagtcatccacctctgattct
gaggggtcctgttgcaactcagaaaaccctaggggaaagccaaggaagcacaaacacgcg
tcaaaggaagctctgaaaagggaacacaccaaaaaagtgaaagagaaaatgaaagggaaa
aaagacaaaaagcataaggccccaaaacgaaaacaggcatttcactggcagcctccacta
gaatttggtgaagaggaggaggaggagagtaatgaaaagcaagtgactcaggagtcacag
gagaaaaaacaagcttctgaaaacagtgaaactacaaaagaaaatatcccccaaactgag
aagccctgtgaagacagcagcctttcagataaacagaatgcagtcacgattttatcagat
actgagcagcctgctaacgatgagagtaaactcagcatttctcccacaccttcagctact
gaggaaaatgtcgctagttctcccccaaacattcagcacattgaagaaagtgtcccaggc
agagtggaagacatgtttcaagccgatgacaacatggagatttgcactcctgacaggagt
tccccagcaaaagtggagggagcatcccctctgggaaattcaaggcttgacaccccagaa
acgggcatcgctgtaaagcaggcagaacatcctgcggcagaggtggggaaacaggaaagc
agcgtgtctgaaagccccacggtgcgggaggtggggaaacctgacagcagctccacgggc
tcagctggtgctgtggaaagcacagcgaggagggaggcggccgaaaggggtcaggtcagc
ctcctggataataaatggaagcccctgcaaggggtggggaacctggcagcaccaacggct
acatccagtgccgtggaagtgaaggcattgacggctgtgcctgaaatgaaaccacaaggc
ttgagaatagaaattaaaagcaaaaataaagttcggcctggatccctctttgatgaagtg
aggaagacagcacgcttaaaccggaggcctagaaatcaggagagttcaagtgatgagcag
acacctagtcgggatggtgacagtcagtccaggagtccaagtcgatctcggagcaaatct
gaaaccaaatcaagacatagaaccaggtctgtctcctacagtcactcacgaagtcgatct
cgaagttccacatcatcttatcgatcgagaagctactctagaagtcggagcagagggtgg
tacagcagaggccgcacaagaagccggagcagttcctcccgcagttacaaaagtcatagg
acgtccagcaggagcaggtccaggagcacctcatacgatccccacagtcggtccagaaaa
gaattaacatttttctgtttaatacgcaggtcctacacttacgacagctactacagcagg
agtcgcagtcgcagccgcagccagaggagcgacagttaccaccgcggcagaagctacaac
cggcggtccaggtgggtccctccccagaacactgcacgtgcccgtgggcactgggtgtgc
gaggcggtagacttaggagagaaagcataa

DBGET integrated database retrieval system