KEGG   Myotis davidii: 102769420Help
Entry
102769420         CDS       T02992                                 

Gene name
BMPR1A
Definition
(RefSeq) bone morphogenetic protein receptor type 1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
myd  Myotis davidii
Pathway
myd04060  Cytokine-cytokine receptor interaction
myd04350  TGF-beta signaling pathway
myd04390  Hippo signaling pathway
myd04550  Signaling pathways regulating pluripotency of stem cells
myd05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102769420 (BMPR1A)
   04390 Hippo signaling pathway
    102769420 (BMPR1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102769420 (BMPR1A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102769420 (BMPR1A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102769420 (BMPR1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myd01001]
    102769420 (BMPR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:myd04090]
    102769420 (BMPR1A)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102769420 (BMPR1A)
Protein kinases [BR:myd01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   102769420 (BMPR1A)
CD molecules [BR:myd04090]
 Proteins
  102769420 (BMPR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2 APH
Motif
Other DBs
NCBI-GeneID: 102769420
NCBI-ProteinID: XP_006767969
Position
Un
AA seq 532 aa AA seqDB search
MTQLYVYVTLLGAYLSIVSHVQGQNLDSMLHGTGMKSDSDQKKSESGVTLAPEDTLPFLK
CYCSGHCPDDAVNNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFLDGSIRWLVVLISMAICIIAMIIFSSCFCYKHYC
KSISSRRRYNRDLEQDEAFIPAGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHEHGSLYDFLKCTTLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNVLIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTRRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactcagctatatgtttacgtcacgttattgggagcctatctgtccatcgtttctcat
gttcaagggcagaatctagacagtatgctccatggcactgggatgaaatcagactctgac
cagaaaaagtcagaaagtggagtcaccttagccccggaagacaccctgccttttctgaag
tgctactgctcaggccactgccccgatgatgctgtcaacaacacgtgcataactaatggg
cattgctttgccatcatagaagaagatgaccagggagaaaccacattagcttcaggatgt
atgaaatatgaaggatctgattttcaatgcaaggactcaccaaaagcccagcttcgccgg
acaatagaatgttgtcggaccaatttatgtaaccagtatttacaacctacactgccccct
gttgttataggtccatttctggatggcagcattcgatggctggtggtgctcatttctatg
gctatctgcataattgctatgatcatcttctccagctgcttttgttacaaacattattgc
aagagcatctcaagcagacgtcgttacaatcgtgacttggagcaggatgaagcatttatc
cccgcgggagagtccctgaaagacctcattgaccagtcgcagagctctggcagcggctcc
gggctgcctttgctggttcagcgaactattgccaaacagattcagatggttcggcaagtt
ggtaaaggtcgatatggagaagtgtggatgggtaaatggcgtggtgagaaggtggcagtc
aaagtgttctttaccactgaagaagctagctggtttcgtgagacggagatctaccagacg
gtgctgatgcgccatgaaaacatcctcggttttatagccgcagacattaaaggcaccggc
tcctggacgcagctgtatctgatcaccgattaccatgagcacgggtctctctatgacttc
ctgaagtgtacaacgctggacaccagggccctgctcaagctggcatactcagctgcctgt
ggtctgtgccacctgcacacggagatttacggcacccaagggaagcccgcaattgctcat
cgagacctaaagagcaaaaacgttctcattaagaaaaatggaagttgttgtattgctgac
ctgggccttgcagttaagttcaatagcgatacaaatgaagtggacgtgcccttgaacacc
agagtgggcacccggcggtacatggccccggaagtgctggacgagagcctcaacaagaac
cacttccagccctacatcatggcagacatctacagcttcggcctgatcatctgggagatg
gctcggcgctgcatcacagggggaatagtagaggagtaccaactgccatattacaacatg
gtgcccagtgacccatcgtatgaagatatgcgtgaggttgtgtgtgtcaaacgtttgcgg
ccaattgtgtctaatagatggaacagtgatgagtgtcttcgagcagtgctgaagctgatg
tcagaatgctgggcccacaacccagcctccagactcacggctctgcggatcaagaagacg
ctggcaaagatggttgaatcccaagatgtaaagatttga

DBGET integrated database retrieval system