KEGG   Myotis davidii: 102771796Help
Entry
102771796         CDS       T02992                                 

Gene name
PLA2G4F
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
myd  Myotis davidii
Pathway
myd00564  Glycerophospholipid metabolism
myd00565  Ether lipid metabolism
myd00590  Arachidonic acid metabolism
myd00591  Linoleic acid metabolism
myd00592  alpha-Linolenic acid metabolism
myd01100  Metabolic pathways
myd04010  MAPK signaling pathway
myd04014  Ras signaling pathway
myd04072  Phospholipase D signaling pathway
myd04217  Necroptosis
myd04270  Vascular smooth muscle contraction
myd04370  VEGF signaling pathway
myd04611  Platelet activation
myd04664  Fc epsilon RI signaling pathway
myd04666  Fc gamma R-mediated phagocytosis
myd04724  Glutamatergic synapse
myd04726  Serotonergic synapse
myd04730  Long-term depression
myd04750  Inflammatory mediator regulation of TRP channels
myd04912  GnRH signaling pathway
myd04913  Ovarian steroidogenesis
myd04921  Oxytocin signaling pathway
myd05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102771796 (PLA2G4F)
   00565 Ether lipid metabolism
    102771796 (PLA2G4F)
   00590 Arachidonic acid metabolism
    102771796 (PLA2G4F)
   00591 Linoleic acid metabolism
    102771796 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    102771796 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102771796 (PLA2G4F)
   04010 MAPK signaling pathway
    102771796 (PLA2G4F)
   04370 VEGF signaling pathway
    102771796 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    102771796 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102771796 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102771796 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    102771796 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    102771796 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102771796 (PLA2G4F)
   04913 Ovarian steroidogenesis
    102771796 (PLA2G4F)
   04921 Oxytocin signaling pathway
    102771796 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102771796 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    102771796 (PLA2G4F)
   04726 Serotonergic synapse
    102771796 (PLA2G4F)
   04730 Long-term depression
    102771796 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102771796 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102771796 (PLA2G4F)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102771796 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 102771796
NCBI-ProteinID: XP_006778126
Position
Un
AA seq 846 aa AA seqDB search
MLWALWPRGLASKGLPLLGVVLLRKREKRGPQWSRCRRETHPYYDLQVKVLKARNIQGKD
LLSKADCYVQLWLPTASPSRAQTKVIDNCSDPEWNETFHYQIHGAMKNVLELTLYDKDVL
GSTELSLLLFDLKSLKPGQPHKHTFLLNQQDSQELQVEFVLENSQVPASEVITNGVLVAQ
PCLKIQGTLGKDETAPQQQYGSRQIRLAVPGAYEKPQLLPLEPPVEAQPPDTFTFHVNPM
LRSRLHVEVGEKLTVLQSDPSAELEAQTSSLGEGGILLSSLALGQEKQRLVAVGKGQEVP
LRVKAEMRXGXLDLRLGFDLCDGEREFLDKRKQIVSKALQQVLGLSQAPASDQVPVVAVL
GSGGGTRAMSSLYGSLAGWQELSLLDTVTYLSGVSGSTWCISTLYKDPAWSQVALQGPTE
QARARVCSSKKGAVSTERLQYYAEELKNLESSSHSISLIDLWGLLIEYFLYQEENPAKLS
DQQEAVSRSQNPYPIYASVNVRSDVSGDDFAEWCEFTPHEVGFPKYGAYVPTKLFGSEFF
MGRLLKLWPEPRICYLQGMWGSAFAANLDEIFQTAGFNLGFLDWHRGSVNVTDDHQKLRD
PTRLRTRLFTPQGPFSQAVLDIFTSRFTSAENFNFTSGLCLHKDYVAGREFVAWKDAHPD
AFPNQLTPMRDSLCLVDGGLAINSPFPLILLSQRAVDLIVSFDYSLDAPFEVLQTTEKYC
LDRGIPFPRIEVLSEDLENPRECYLFARAEDPHAPIVLHFPLVNRTFRTHLAPGVERQTA
EEKAFGDFDINGPDTPYGMMNFTYEPEQFDRLVALSRYNVLNNVETIKQALQLALDRRQA
GARAGG
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcgctctggccaagggggctggcaagcaaggggctgcctctcctgggggta
gtgttgctgcgaaaaagagagaagaggggacctcagtggagtcgctgccggcgggaaacc
cacccatactatgacctccaggtgaaagtgctgaaggccagaaacatccagggcaaagac
ctgctgtccaaagctgactgctacgtgcaactgtggctgcccacggcatctcccagccgc
gcccagacaaaggtgatagacaactgcagtgaccctgagtggaatgagaccttccactac
cagatccatggcgctatgaagaatgtcctggagctcaccctctatgacaaggacgtcctg
ggcagcactgaactctccctgctgctgtttgacctgaagagcctcaaacctggtcaaccc
cacaaacacaccttcctactcaaccaacaggattcacaagagctgcaggtggagtttgtt
ttggagaacagccaggtgcctgcatctgaagtcatcaccaatggcgtcctggtggctcag
ccctgtctgaaaatccaaggcacccttgggaaagatgagacagctccacagcaacagtat
ggctctaggcagattcgtctggcagtgcccggggcctacgagaaaccacagctcttgccc
ctggagccccccgtggaggctcagcccccagacacctttaccttccatgtgaatccaatg
cttcgctccaggttgcacgtggaggtgggggagaagctcacggttctgcagagcgacccg
agcgctgagctggaggctcagaccagcagtctgggcgaggggggcatcctgctctcctct
ctggccctaggtcaggagaaacagcgcttggtggctgtggggaagggccaggaggtgcct
ctgagggtgaaggcagaaatgaggtgaggnnnncttgacctgcgccttggctttgacctc
tgtgatggggaacgagagtttctggacaagaggaagcagatcgtatccaaggccctgcag
caggtgctgggattgagccaggctcccgccagtgaccaggtgcctgtggtggctgtgctg
ggctctggaggcggaacccgtgccatgtcttccctgtacggcagcctggcaggatggcag
gagctcagtctcctggacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctataaggacccagcttggtcccaggtggccttgcagggccccactgag
caggcccgggcgcgggtctgcagcagtaagaagggggcggtatccacggagcgcctacag
tactatgctgaggaactgaagaacctggaaagcagcagccatagcatctccctcattgac
ctctggggcctcctcattgaatatttcctgtaccaggaggaaaaccccgccaagctgtct
gaccagcaggaggcagtgagccgcagccagaacccttatcccatctacgccagcgtcaac
gtccgcagcgatgtcagcggggacgactttgcagagtggtgcgagtttaccccccacgag
gtcggcttccccaagtatggggcttatgttcccaccaagctcttcggctcagagttcttc
atggggcgactgctgaagctctggccagagccccggatctgctacctgcagggcatgtgg
ggcagcgcctttgcagccaacctggatgagatcttccagaccgcgggcttcaacctcggc
ttcctggactggcaccgaggcagtgtgaacgtcacagacgaccaccagaagcttcgagac
cccacgaggctgcgaacgaggctcttcaccccccaggggcccttctcccaggccgtgctg
gacatattcacctcccgcttcacctccgcggagaacttcaacttcaccagtggcctctgt
ctgcacaaggactatgtggctggcagggagtttgtggcctggaaagacgcacacccggac
gccttccccaaccagctcactcccatgcgggattccctgtgcctggtggatgggggcctt
gccatcaactctccattcccgctgatcctgctgtcgcagagagcggtggacctcattgtg
tcttttgactactccctggatgccccttttgaggtcttacagacgacagagaagtactgc
ctggaccgaggcatccccttccccagaattgaggtgctctctgaggatctggagaaccct
cgcgagtgctacctgtttgccagggcggaggacccccacgcacccatcgtgctgcacttc
cccctggtcaaccgaaccttccgtacacacctggccccaggtgtggagcgacaaacagct
gaagagaaggcctttggggactttgacatcaatgggccagataccccctatggtatgatg
aacttcacctatgaacccgagcagtttgatcggcttgtagccctgagtcgatacaatgtt
ctgaacaatgtggagaccatcaagcaggccctccaactggctctggaccggcggcaggct
ggggcccgggctggaggctga

DBGET integrated database retrieval system