KEGG   Myotis davidii: 102772343Help
Entry
102772343         CDS       T02992                                 

Gene name
RARS2
Definition
(RefSeq) arginyl-tRNA synthetase 2, mitochondrial
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
myd  Myotis davidii
Pathway
myd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102772343 (RARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:myd01007]
    102772343 (RARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:myd03016]
    102772343 (RARS2)
   03029 Mitochondrial biogenesis [BR:myd03029]
    102772343 (RARS2)
Enzymes [BR:myd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     102772343 (RARS2)
Amino acid related enzymes [BR:myd01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   102772343 (RARS2)
Transfer RNA biogenesis [BR:myd03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102772343 (RARS2)
 Prokaryotic Type
   Other AARSs
    102772343 (RARS2)
Mitochondrial biogenesis [BR:myd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102772343 (RARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1
Motif
Other DBs
NCBI-GeneID: 102772343
NCBI-ProteinID: XP_006773551
Position
Un
AA seq 577 aa AA seqDB search
MACGFRRSIAGQLSRVLDLPPENLIKSISAVPVSRKEEVADFQLSVDSLLGNNDYSRPDI
QVQATQLAEKLKCDTVVTEISTGQGTVNFKINRELLTKTVLKQVIEDGSKYGLKSELFSG
LPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVTRINYLGDWGMQFGLL
GTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEAAEDKSVAKSAHDFFQRLELGDMQALALW
QKFRDLSVEEYIRIYKRLGVHFDEYSGESFYREKSQEVLKLLDSKGLLQKTVKGTAVVDL
SGNGDPSSVCTVMRSDGTSLYATRDLAAAIDRMDKYNFDTMIYVTDKGQIKHFQQVFQML
QIMGYDWAKRCQHVPFGVVQGMRTRRGDVTFLEDVLNEIRLRMLQNMASIKTTKELENPQ
ETAERVGLAALVIQDFRGSLLSDYQFSWDRVFQSRGDTGVFLQYTHARLHSLEETFGCGY
LDDYNTACLQEPQSVSILQHLLRFDEVLYRSSQDLQPRHIVSYLLTLSHLAAVAHRTLPI
KQSPPEVAGARLHLFRAVRSVLANGMKLLGITPVCRM
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcggcttccgcaggtccatcgccggtcagctttccagagtattggatcttcca
ccagaaaacttgatcaagtcaatatctgcagttccagtttccagaaaagaagaagtagct
gattttcagctttctgtggattctctgttggggaacaatgactattcaagaccagatatt
caagttcaagccacacaactggcagagaagctaaaatgtgatacagtggtgactgaaatc
agcactggtcaagggactgtaaatttcaaaataaacagagaactattaacaaagacagtg
ttaaaacaagttatcgaagatggttcaaaatatggattaaaaagtgagcttttctctggt
cttccccagaagaagattgtggttgaattcagttcacctaacgttgccaaaaaatttcac
gttggacatttgcgttctaccatcataggaaatttcatagcaaatctcaaagaagcttta
ggacatcaagtaacgagaataaattaccttggagattggggtatgcagtttggtcttctg
gggactggcttccaactgtttggctatgaagaaaagctccagtccaatcctttgcagcat
ctctttgaagtttacgtacaagttaataaagaagcagcagaagacaaaagtgtagccaaa
tcagcacatgatttcttccagcgattggaactaggtgacatgcaagcacttgcactatgg
caaaaatttcgggacttgagcgtagaagagtacattcggatttacaagcgtctaggagta
cattttgatgaatactcaggagaatcattttatcgtgaaaaatctcaagaagtcttaaag
ttgctggacagtaaaggactcctgcagaaaacagtaaaaggaacggctgtagtggatctt
tctgggaatggtgacccttcctcagtttgtactgtgatgcgtagtgatgggacatctctg
tatgcaaccagagatcttgcagctgctatagatcgaatggacaaatataattttgataca
atgatttatgtgacagataaagggcaaataaagcattttcagcaagtgttccagatgctg
cagatcatgggatatgactgggcaaaaaggtgccaacatgtgcccttcggagtggtgcag
ggaatgaggactcgaagaggagatgtcacttttctggaagatgtcttaaatgagattcga
ttaaggatgctacagaacatggcttctattaagaccaccaaggaactggagaacccgcag
gagactgcagagagggtcgggctggcagcgctcgttattcaggacttcagaggttccctc
ttatctgactatcagttcagctgggaccgtgtcttccagagtcgtggggacacaggtgtc
ttcctgcagtacacgcacgcccgcctccacagtttggaagagacttttggatgtggttat
ctggatgactacaacactgcttgtttacaagagccgcagtctgtttcaattctccagcat
cttctcaggtttgacgaagtgctttatagatcatctcaggaccttcaacccaggcacatt
gtcagctaccttctaactctaagtcaccttgcagctgtagcacacagaacactgcccata
aaacagagtcctcctgaagtggctggggccagacttcatcttttcagagctgtccgttct
gtcctagccaatggaatgaaacttcttggaataacacctgtatgtaggatgtaa

DBGET integrated database retrieval system