KEGG   Myotis davidii: 102774135
Entry
102774135         CDS       T02992                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
myd  Myotis davidii
Pathway
myd00100  Steroid biosynthesis
myd01100  Metabolic pathways
Module
myd_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102774135 (TM7SF2)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102774135 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 102774135
NCBI-ProteinID: XP_006771775
UniProt: L5LEP7
Position
Un
AA seq 335 aa
MAEGQELKDKSRLRYPINGFQALVVTALLVGLGVSAGLPLGMLTEMLLPLAWVATLTAFI
FSLLLYLKALMAPASALAPGGNSGNPLYDFFLGRELNPRFGSFDCKYFCELRPGLIGWVL
INLALLVQEAELRGSPSVAMWLVNGFQLLYVGDALWHEEAVLTTMDITHDGFGFMLAFGD
LAWVPFTYSLQAQFLLHHPQPLELPTASVICLVNAVGYYIFRGANSQKNTFRKNPSDPRV
AGLETISTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFYLLYFTALL
VHREARDEQQCLQKYGLAWHEYCRRVPYRIVPYIY
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggctgagggccaggaattgaaggacaagagtcgcctgcgctaccccatcaacggcttc
caggccctggtggtgacagccctgctggtgggcctgggggtgtcggctgggctgcccctg
ggaatgctcacggaaatgctcctgcccttggcgtgggtggccaccctcacggccttcatc
ttcagcctcctcctctatctgaaggcgctaatggccccagcctccgccctggcacccgga
gggaactcaggcaatcccctttacgactttttcttgggacgggagctcaacccgcgcttc
ggttcctttgactgcaaatacttctgcgaactgcggcctggcctcatcggctgggtcctc
atcaacctggctctgctggttcaggaagcagaacttcgggggagtccctccgtggccatg
tggctggtcaatggcttccagttactctatgtgggtgatgccctctggcacgaggaagct
gtactcaccaccatggacatcacacacgacgggtttggcttcatgctggcctttggggac
ctcgcctgggtacccttcacctacagcctgcaggcccagttcctgctgcaccacccacag
cccctggagttacccacggcctcagtcatctgccttgtcaatgctgtcggttactacatc
ttccgtggagccaactcccagaaaaacaccttccgaaagaacccttctgatcccagagtg
gccggccttgagaccatctctacagccacggggaggcagctgctagtgtctgggtggtgg
ggtatggtccgccatcccaactatctgggagacctcattatggctctggcctggtccttg
ccctgtggggtgtcccacctgctgccttacttctacctcctctacttcactgcgctgctg
gtgcaccgtgaggcccgggacgagcagcagtgcctgcaaaagtacggcctggcctggcat
gaatattgccggcgtgtgccctaccgaattgtgccttatatctactga

DBGET integrated database retrieval system