KEGG   Myotis davidii: 102774449
Entry
102774449         CDS       T02992                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:myd01002]
    102774449 (ERAP1)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102774449 (ERAP1)
Peptidases and inhibitors [BR:myd01002]
 Metallo peptidases
  Family M1
   102774449 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102774449
NCBI-ProteinID: XP_006775620
Position
Un
AA seq 944 aa
MKMISLSSKWSLRTMSFLLSSLLILLVVPTPSCCQSSETAPPRTSDGTLFPWNKMRLPEH
IVPVHYDLLIHANLTTLTFEGTTAINITASQPTSAIILHSQHLQILRATLKRGAGETQSE
EPLRVLEYPPREQIALLAPRPLEVGLPYTVVLGYAANLSESFRGFYKSTYRTKEGEVRIL
ASTQFEPTAARMAFPCFDEPAFKATFSIKIRREPRHLALSNMPLVKSVTIAEGLIEDHFD
VTVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKITQADYALDAAVTLLEFYEDYF
SIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVSHELAH
QWFGNLVTMEWWNDLWLNEGFAKFMEFVSVRVQYPELKVEDYFLGKCFNAMEVDALNSSH
PVSTHVENPAQIREMFDEVSYDKGSCILNMLRDYLSADTFKSGIVHYLQTYSYKNTKNED
LWNSMASICPTDSSQRMEGFCSRGQHSSSSSHWQQEGLDVKAMMNTWTLQKGFPLITVTV
KGRNVHLKQEHYMKGSEGSPESGYLWHVPLTFITSKSESTQRFLLKTKTDVLILPEEVEW
IKFNVGMNGYYIVHYEDDGWDSLTGLLQGTHTAISSNDRASLINNAFQLVSIGKLPIEKA
LNLTLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVEIQFKGFLIRLLRGLIDKQAWT
DEGSVSERMLRSQLLLLACVRKYQPCVQRAEGYFREWKETNGDLRLPNDVTMAVFAVGAQ
TTEGWDFLYHKYQSSLSSTEKNQIEFALCISQNKEKLQWLLEQSFKGDVIKTQEFPDILR
AIGRNPVGYPLAWQFLRENWNKLIQKFDLGSPSIAHMVMGTTNQFSTRARLEEVKEFFSS
LKENGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQNQNLELL
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgaagatgatatctctgtccagcaaatggtcacttagaaccatgtcatttctactttcc
tcactgttgattctcttagttgtgccaactccttcctgctgtcagagtagtgaaactgca
cctccaagaactagtgatgggaccctgtttccttggaataagatgagacttcctgagcac
atcgtcccagttcattatgacctcctcatccatgccaacctcaccactctgacttttgag
gggaccacggcaatcaacatcacagccagccagcccaccagtgccatcatcctgcacagt
cagcacctgcagatattgagagccaccctcaagaggggagctggagagacgcagtctgaa
gaaccgctgcgagtcctggaatacccgcctcgtgagcagatcgcccttctggctcccagg
cctctggaggtggggctcccgtacacagttgtccttggttacgctgccaatctttcggag
agcttccgtggattttataaaagcacctacagaaccaaggaaggggaagtgaggattctt
gcatcaacacagtttgaacctactgcagccagaatggcctttccctgcttcgatgaacct
gccttcaaagcgactttttccatcaagatcagaagggagccaaggcacctcgccctctcc
aatatgccactggttaaatccgtgaccatcgctgaaggactcatagaagaccattttgat
gtcaccgtcaagatgagcacctacctcgtggccttcattatctcagactttaagtccgtc
agcaagatgaccaagagcggagtcaaggtgtccgtgtatgccgtgccagacaagatcacc
caggcagactatgcactggatgctgcggtgactcttctggaattttatgaggattatttt
agcattccgtatcccttacccaaacaagatcttgctgcgattcctgactttcagtctggt
gcgatggaaaactggggactgaccacctatcgggaatctgctctcttgtttgatgcggaa
aagtcttctgcatcaagtaagcttggcatcacgatgactgtgtcccatgagctcgcccac
cagtggtttgggaacctggtcactatggaatggtggaatgatctttggctcaatgaggga
tttgccaagtttatggagtttgtatctgttcgtgtgcaatatccagaactgaaagttgaa
gattatttccttggcaagtgttttaatgcaatggaggtagacgcattgaattcttcacac
cctgtgtccacacatgtggagaatcctgctcagattcgggagatgtttgatgaggtttct
tatgataagggatcttgtattctgaatatgctaagagattatcttagtgccgatacattt
aaaagtggtattgtacattatctgcagacgtatagttataaaaacacaaagaacgaggac
ctgtggaacagtatggcgagtatttgccctacagacagctcacaaaggatggagggcttt
tgctctcggggtcaacattcatcttcatcctcacactggcaacaggaaggccttgatgtg
aaagccatgatgaacacctggacgctgcagaagggcttccccctgataaccgtcacagtg
aaagggaggaacgtccacctgaagcaagagcactatatgaaaggctctgaaggcagccca
gaatctgggtacctgtggcatgttccactgacattcatcaccagcaaatcagaatcgacc
cagagatttttgctgaagacaaaaacagatgtgctcatcctcccagaagaggtggaatgg
atcaaatttaacgtgggaatgaatggctattacattgtgcattatgaggatgatggatgg
gattctctgactggccttttacaaggaacgcacacagcaatcagcagtaatgatcgggcc
agtctcattaacaatgcatttcagcttgtcagcattggaaagctaccgattgaaaaagcc
ttgaatttaaccctgtacttgaaacatgaaacagaaattatgcctgtgttccaaggtttg
aatgagctgatacctatgtataagttaatggagaaaagagatatgaatgaagtggaaatt
caattcaagggctttctcatcaggctgctgaggggcctcattgacaagcaggcatggact
gacgagggctctgtctcagagcgaatgctgcggagccagctcctcctcctcgcctgtgtg
cgcaagtatcagccctgcgtgcagagggcagaaggctacttcagagagtggaaggaaacc
aatggagatttgaggctgcccaatgatgtgacgatggcagtgtttgctgtgggagcccag
accactgagggatgggattttctctatcataaatatcaatcttctctgtccagtaccgag
aaaaaccaaattgaatttgccctctgtattagccaaaacaaggaaaagcttcagtggtta
ctagagcaaagttttaagggagatgtaataaaaactcaagagtttccagatatccttaga
gctattggcagaaacccagtgggatatccactggcctggcaatttctgagggaaaactgg
aataaacttatacaaaagtttgaccttggctcaccttccatagcccacatggtgatggga
acaacaaatcagttctccacaagggcacggcttgaagaggtaaaagaattcttcagctct
ttgaaagaaaacggttctcagctccgttgtgtccaacagacaattgaaaccattgaggaa
aacatacgttggatggataagaatttcgataaaatcagagtgtggctccaaaaccaaaat
ctcgaactgctttaa

DBGET integrated database retrieval system