KEGG   Myotis davidii: 102774607
Entry
102774607         CDS       T02992                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:myd03021]
    102774607 (AFF3)
Transcription machinery [BR:myd03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102774607 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 102774607
NCBI-ProteinID: XP_015417297
Position
Un
AA seq 1243 aa
MSLCPLLGPRGQKADQLTHAQIQGLVRFQCFPFCGVCVSYRGEDILNQRSDSLVVEFQSS
TSRCRSVYEPDRNVLRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNT
LGNYDEMKDFLTDRSNQSHLVGVPKPGVPQAAVNKIEEHFVADSRAQAQASSVGSTASST
PAAVPGQQSKRGTVGWQKAGHPPPDGPPRATQQSSLRTLLGDGAGRQQPRAKQVCNVEVG
LQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLK
SSTETSVHCTSYRGVPAAKPESTRAKAKLSKFSIPKPSEESRSGETNSCVEEIIREMTWL
PPLSAIQPPGKVEPSKFSFPNKDSQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKL
SSDEEEGEQAAQGTALHALSDSAGVQQAGCRASVPSSKGSSSGSSSSGSSSSSDSESSSG
SDSESESSSSESEGSKPAHYSSPEAEPASSNKWQLDKWLNKVNPHKPPVLIQNESHGLES
SQYYAPGKDPAQDCGKLADGCQAGLREKDVKSACKEEQRPRTANKAPGTKGVKQKSLQVA
GKKPPRRTERTSAGESTNCQRPEEPADALGASAAIPPIPPEPTKARPCANSRTSHRKELR
ASVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLAKAPAVAAASAS
DQRLKEAAGSISSSGGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDE
VRSLWVKIDLTLLSRIPEHLPQEAAALSTPAAKDAESAPPSHPSDTPVEKALPKSKRKRK
CDNEDDYREVKKVQGEKESSSRQAASASNTVSANPCNMNVSSLAIPINKNEKLLRSPLSP
LSDASKHKYSSEDLTSSSRSSGSGLFPSTASNKKLKMESQLPAHAADLTKAAHHSSESVL
HKPRPQTEPWSPGSSSHRDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALN
YAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAAL
CYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGAGGKSTGTPSPMSPN
PSPTSSVGSQGSLSNTSALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAK
ENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLP
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgtccttgtgccctctgcttggccctcgggggcaaaaagcagaccagctcacgcacgct
cagatacaagggctggtcaggtttcaatgttttcccttctgtggtgtctgcgtttcttac
aggggtgaagacatcttaaaccagaggagtgactctctagtcgtggaatttcagtcgtca
accagccggtgcaggagtgtctatgaaccagatagaaatgtgttacggaggaaagaacga
gaaaggagaaatcaggagactcaacaggacgatggcacatttaattccagttattccctc
ttcagtgaaccctacaagactaacaagggggatgagctctccaaccggatccagaatacg
ctaggcaattacgacgaaatgaaggactttttaactgatagatctaatcagagtcatctc
gttggcgttcccaaacctggggttcctcaggctgctgtgaacaagatcgaggaacatttt
gttgcagattcaagagcccaggcccaggcctcctctgtgggcagcacggcgtcttccaca
ccagcggctgtgcccgggcagcagagtaagaggggcaccgtgggctggcagaaggctggg
cacccgcctcccgacggcccaccgagagcaacacaacagagctctctcaggaccttgctt
ggagatggcgctggcaggcagcagccacgggccaaacaggtgtgcaatgtagaggtgggt
cttcagacccaggaaagaccacccgccatggcagccaagcacagcagcagtggacactgt
gttcagaactttcctccatccctggcttccaaacccagcctggtccagcagaaaccgacc
gcatatgtgcggccgatggatggccaagatcaggctcccgatgagtctccgaagcttaag
tcgtccacggaaaccagcgtgcactgcacgtcatacaggggcgtcccggccgccaagcca
gagtccaccagagccaaggccaagctttccaagttcagcatccccaagccatcggaggag
agtcgatctggagaaaccaacagctgtgtggaagaaataatccgggagatgacctggctt
ccaccactttctgctattcagccgcctggcaaggtggaacccagcaaattttcattccca
aataaggactctcagctggtttcctctggacacaataatccaaagaaaggtgatgctgag
cccgagagtccagacaatggcacctcgaatacatcaatgctagaagatgacctcaagcta
agcagtgatgaagaggagggtgaacaggcagcccagggaaccgcgctccacgctctgtct
gacagcgccggggtccagcaggccggctgcagagcctcggtgccctccagcaagggcagc
agcagcggcagcagcagcagcggcagcagttcgtccagcgactcggagagcagctcggga
tccgactccgagagcgagagcagctccagcgagagcgagggcagcaagcccgcccactac
tccagccccgaggctgagcccgcgtcctctaacaagtggcagctggataaatggctaaac
aaagttaatccccacaagccgcctgttctgatccagaatgaaagccacggcctggagagc
agtcagtactatgcccccgggaaggaccccgcgcaggactgcgggaaactcgccgacggg
tgccaggccggcctgagggagaaggacgtcaagagcgcctgcaaggaagagcagaggcca
aggacagccaacaaggccccggggacgaagggggtgaagcagaagtccctgcaggttgcg
ggcaagaagccccccaggcgcacggagaggacctctgccggcgagagcactaactgccag
cggccggaggagcccgcggatgcgctgggggcaagcgccgcaatccctcccatccctccg
gagcccaccaaagccaggccctgtgccaacagcaggacgagccaccgcaaggagctgcgc
gcctcggtcacctgcgagaagcgccgcacgcggggcctaagcaggatcgtccccaagtcc
aaggagttcatcgagacagagtcctcatcttcgtcctcctcctcggactccgacctggag
tcggagcaggaggagtaccctctggccaaagcgccggccgtggccgccgcctctgcaagt
gaccagaggctcaaggaggccgctggcagcatcagcagcagcggcggaccccgcgcaccc
gtgggctccatcaacgccaggaccaccagcgacatcgccaaggagctggaggagcagttc
tacacgctggtccccttcggccgcaacgaacttctctcccccctgaaggacagtgacgag
gtcaggtctctctgggtcaaaattgacctgaccctcctgtccaggatcccagaacacttg
ccccaggaggccgcggccctcagcacgcctgcagccaaggacgctgagagcgcacctcca
agccacccatccgacacacccgtagaaaaggctttgcccaaatccaagaggaaacgcaag
tgtgacaacgaagatgactaccgggaggtcaagaaggtccagggagagaaagagagctct
tcccggcaggccgcctctgccagtaacactgtgtctgcgaatccttgcaacatgaacgtc
agcagcttggcaatacccatcaataaaaatgaaaagctgctccggtcgcccctctcgccc
ctctccgacgcctctaaacacaaatactccagcgaggacttgacgtcttccagcaggtcc
agcggcagtggcttgttcccttccaccgcctccaacaaaaagctcaagatggagagccag
ctgccggctcatgccgcagacctcacgaaagcagctcaccacagctcggaaagcgttctc
cacaagccacggccacagacggagccgtggtccccgggctccagcagccaccgggactgc
aagaggcagaaactcgtcttcgacgacatgccacgcagtgcagattattttatgcaagaa
gctaagcggatgaagcataaggcagatgcaatggtggaaaagtttggaaaggctttgaac
tacgccgaagcagccttgtcattcattgagtgtggaaatgcaatggaacagggcccgatg
gaatccaaatctccatacacgatgtattcagaaacagtggaactcatcaggtatgctatg
agactaaagacccactcaggccccaatgccacaccagaggataaacagctggctgcgtta
tgttaccgatgcctggctctcctgtactggcggatgtttcgactcaaaagggatcacgct
gtcaagtattcaaaagcacttatcgactatttcaagaattcatctaaagctgcccaagcc
ccatctccatggggagccggtggaaagagcactggaaccccatcccccatgtcccccaac
ccctcccccaccagctccgtgggatctcaggggagcctctccaataccagcgccctgtcc
ccttccaccatcgtcagcatcccacagcgcatccaccagatggcagccaatcacgtcagc
atcaccaacagcattctccacagctacgactactgggagatggcagacaacctggccaag
gaaaaccgagagttcttcaacgacctggatctgctcatggggccggtcaccctgcacagc
agcatggagcacctcgtccagtactcccagcagggcctgcactggctgcggaacagcgcc
cacctgccgtag

DBGET integrated database retrieval system