KEGG   Myotis davidii: 102774977Help
Entry
102774977         CDS       T02992                                 

Gene name
PUDP
Definition
(RefSeq) pseudouridine 5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myd01009]
    102774977 (PUDP)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     102774977 (PUDP)
Protein phosphatases and associated proteins [BR:myd01009]
 HAD phosphatases
  Other HAD phosphatases
   102774977 (PUDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_like HAD_2
Motif
Other DBs
NCBI-GeneID: 102774977
NCBI-ProteinID: XP_015421445
Position
Un
AA seq 215 aa AA seqDB search
MPGSPPSPAACPQPPVIARTIGRSSLRFRSTYTTPARARPRLDVHVARTPIIPHLRLAFV
SADTERLYSVAFNEICGRYGKQYSWDVKSLVMGKKALEAAQIIIDVLQLPTTKEELVDES
QARLKELFPTAALMPGGGPLRPGGALSRPSPPAPPDQCLVFEDAPNGVEAALAAGMQVVM
VPDGNLRRELTTKATVVLASLQDFQPALLGLPPFA
NT seq 644 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctcacccccctctccagccgcatgcccacagccccccgtgattgcccgcacc
atcggccgctccagcctgcgtttcagatccacgtacaccacaccagccagggcgcgcccc
agactcgatgtgcacgtggcccgcacgccaatcatcccccatctccgtctcgcctttgtc
tccgcagacacggaacggctgtactcggtggcgtttaatgaaatctgcggtcgctatggg
aagcagtacagctgggacgtcaagtccctggtgatgggcaagaaggcgctggaggctgca
cagatcatcatagacgtgctgcagctgcccacgaccaaggaggagctggtggacgagagc
caggcccggctcaaggagctgttccccaccgcggccctcatgccaggtggggggccattg
aggcctgggggtgcactcagtcggccctcgcccccggcgcccccggaccagtgcctggtc
ttcgaagacgcccccaacggggtggaggcggccctggcggccgggatgcaggtggtgatg
gtcccggacggaaacctgcgccgcgagctgaccacgaaggccacggtggtgctggcctcc
ctgcaggacttccagccagctcttctcgggctgccgcccttcgc

DBGET integrated database retrieval system