KEGG   Myotis davidii: 102775104Help
Entry
102775104         CDS       T02992                                 

Gene name
B4GALT4
Definition
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
myd  Myotis davidii
Pathway
myd00533  Glycosaminoglycan biosynthesis - keratan sulfate
myd00601  Glycosphingolipid biosynthesis - lacto and neolacto series
myd01100  Metabolic pathways
Module
myd_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    102775104 (B4GALT4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    102775104 (B4GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:myd01003]
    102775104 (B4GALT4)
Enzymes [BR:myd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     102775104 (B4GALT4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     102775104 (B4GALT4)
    2.4.1.-  
     102775104 (B4GALT4)
Glycosyltransferases [BR:myd01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   102775104 (B4GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 102775104
NCBI-ProteinID: XP_015414750
UniProt: L5MD98
Position
Un
AA seq 344 aa AA seqDB search
MGFHVTSFLSYKLRLLLLFTLCLTVVGWATSNYFVSAIQEIPKAKDFITTFKKAMVLGKK
ETLADEASVKRADLDDCPSVSPHLRGQDKLVFKPDLTLEDVQAENPKVHRGRYHPEECKA
LQRVAILIPHRNRERHLMYLLEHLHPFLQRQQLEYGIYIIHQAGSKKFNRAKLLNVGYIE
ALKDEMWDCFIFHDVDLVPENDLNLYRCEDQPKHLVVGRNSTGYRLRYNGYFGGVTALSR
EQFFKVNGFSNNYWGWGGEDDDLRLRVELHRMKIIRPMPDVGKYTMIFHTRDRGNEVNIG
RMKLLHQVSRVWRTDGLNSCVYKLLSVDYNPLYVNITVDFWSGP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggcttccacgtgacttccttcctttcctacaaactccggttactcttgctttttact
ttatgcctgacggtggtggggtgggccaccagtaactactttgtcagtgctattcaggag
attcctaaagcaaaggatttcattactactttcaaaaaggccatggttttggggaagaaa
gaaactctggctgacgaagcctctgtgaaaagagcagacctggacgactgcccttccgtc
tctccacacctcagaggtcaggacaagctcgttttcaaaccagatcttactctggaagac
gtgcaggcagaaaatcccaaagtgcacagaggccggtatcaccccgaggaatgtaaggct
ttacagcgggttgccatcctcattccacaccggaaccgagagagacacctgatgtacctg
ctagaacaccttcatcccttcttgcagaggcagcagctggaatatggcatctacatcatc
caccaggctgggagtaaaaagtttaatcgagccaaactcttgaatgtgggctatatagaa
gctctcaaggatgaaatgtgggactgctttattttccacgatgtggacctggtgcccgag
aatgacctgaatctttacaggtgtgaggatcagcccaagcacctggtggtgggcaggaac
agcactggctacaggttgcgttacaacggatattttgggggtgttactgccctaagccga
gagcaatttttcaaggtgaatggattctctaacaactactggggatggggaggcgaagac
gatgacctcagactcagggttgaacttcatagaatgaaaataatccggccgatgcctgat
gtgggcaaatatacaatgatctttcacactagagaccgaggcaatgaggtgaacataggg
cggatgaagctcttacatcaggtgtcacgagtctggaggacagatgggttgaacagttgt
gtttataaattactatccgtggattacaatcctttatatgtcaacatcacggtggacttc
tggtctggcccatga

DBGET integrated database retrieval system