KEGG   Mycobacterium sp. EPa45: AB431_03135Help
Entry
AB431_03135       CDS       T03960                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00430  Taurine and hypotaurine metabolism
mye00620  Pyruvate metabolism
mye00640  Propanoate metabolism
mye00680  Methane metabolism
mye01100  Metabolic pathways
mye01120  Microbial metabolism in diverse environments
mye01200  Carbon metabolism
Module
mye_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB431_03135
   00640 Propanoate metabolism
    AB431_03135
  09102 Energy metabolism
   00680 Methane metabolism
    AB431_03135
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AB431_03135
Enzymes [BR:mye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AB431_03135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AKK25861
UniProt: A0A0G3IKK8
Position
692659..693846
Genome map
AA seq 395 aa AA seqDB search
MSSTVLVLNSGSSSLKYQLLEPDTAASLAHGIVERIGESTSTATLVLGNNEIRRDGRIAD
HEAALRTAFDLFAETGQALDGLGLIAVGHRVVHGGEDLYRPTIVDDALIAKLRELAPLAP
LHNPPAVLGIEVARKVLPDLAHVAVFDTAFFHDLPAAATTYAIDRDLARRWQIRRYGFHG
TSHQYVRQQAARFLGAPIESLNQIVLHLGNGASASAIAGGRPVDTSMGLTPMEGLVMGTR
SGDIDPGVLVYLWRSCDMGVEDIETMLNRRSGMYGLSGEIDFRAIHRRIESGDDAAQLAY
DVYIHRLRKYLGAYLAILGHTDVVTFTAGVGENDARVRRDALTGLAPLGIELDEHLNDSP
AGAARRISAEKSPTTVLVIPTNEELAIAQACLTVV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagctctactgttctggtattgaactccggctcgtcgtcactgaaatatcagctactg
gaaccagataccgccgcgtcgctggcccacgggatcgtcgaacggatcggggagtcgacg
tcaacggcgaccctggtgctgggcaacaacgagattcggcgcgacggccgcatcgccgat
cacgaagcggccctgcggaccgcgttcgacctgttcgccgagaccggccaagcgttggac
ggattgggactgatcgccgttggtcaccgcgtggtgcatggcggcgaggatctgtaccgg
cccacgatcgtcgacgacgcgctgatcgccaaactgcgggaactcgccccgctggcgcca
ctgcataatcccccggcggtgctgggcatcgaggtggcccgtaaggtgctgcccgacctg
gctcacgtcgcggtcttcgacaccgccttcttccacgatctacccgccgccgcgaccacc
tatgcgatcgatcgggatctggccagacgatggcagattcgccgctacggcttccacggc
acttcgcaccaatatgtgcgccagcaggccgcgcgttttctgggcgccccgatcgaatcg
ctcaaccagatcgtcctccacctcggcaatggcgcctcggcgtcggcgatcgccggtggc
cgccccgtcgacacctcgatggggcttacgccgatggagggtctggtgatgggcacccgc
tccggtgacatcgacccgggcgtgctcgtctacctgtggcgctcctgcgacatgggtgtc
gaggacatcgagacgatgctcaaccggcgctccggaatgtacgggctcagcggtgagata
gacttccgcgccatccaccggcgaatcgaaagtggcgacgacgcagctcaattggcttac
gacgtctacatccaccggttgcgcaaatacctcggcgcctatctggcgatcctgggccat
accgatgtggtgacgttcaccgcgggcgtgggggagaacgatgcgcgtgtacggcgcgac
gcgctgaccgggctggcgccactggggatcgaactcgacgagcacctcaacgacagtccg
gccggagctgcccgacggatctccgccgagaagtcgcccacgacagtgctcgtgatcccg
acgaacgaggaactggcgatcgcgcaggcctgcctgacagtggtctag

DBGET integrated database retrieval system