KEGG   Mycobacterium sp. EPa45: AB431_10590Help
Entry
AB431_10590       CDS       T03960                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00020  Citrate cycle (TCA cycle)
mye00620  Pyruvate metabolism
mye01100  Metabolic pathways
mye01120  Microbial metabolism in diverse environments
mye01200  Carbon metabolism
mye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AB431_10590
   00620 Pyruvate metabolism
    AB431_10590
Enzymes [BR:mye01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AB431_10590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp RnfC_N GCV_H AstE_AspA NQRA ATP-grasp_3 Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AKK27048
UniProt: A0A0G3IHP8
Position
2231108..2234515
Genome map
AA seq 1135 aa AA seqDB search
MISKVLVANRGEIAIRAFRAAYEMGIGTVAVFPFEDRNSLHRLKADESYQIGEIGHPVRA
YLSVDEIVATAEAAGADAIYPGYGFLSENPELAAACAASGITFIGPDASILELTGNKARA
IAAARDAGLPVLASSAPSASVEELVAAAQSMDFPLFVKAVAGGGGRGMRRVTEPAALPEA
IEAASREAESAFGDPTVFLEQAVVNPRHIEVQILADTYGNVIHLYERDCSVQRRHQKVIE
LAPAPNLDPALRDQICADAVAFAHHIGYSCAGTVEFLLDERGRHVFIEMNPRIQVEHTVT
EEITDVDLVSAQLRIAAGETLADLGLSQDRIAPHGAALQCRITTEDPANGFRPDTGRITT
YRSPGGAGIRLDGGTHLGAEVTAHFDSMLVKLTCRGRDFPTAVARAKRAVAEFRIRGVST
NIPFLQAVLDDPDFQAGRITTSFIDERPELLTARTSADRGTKMLKFLAEVTVNSPYRDRP
RYYPQDKLPDIDIAASAPPGSKQRLDELGPQGFAQWLKDSPAIGVTDTTFRDAHQSLLAT
RVRTSGLLKVAPYIARMTPELLSIECWGGATYDVALRFLKEDPWERLAALREAIPNICLQ
MLLRGRNTVGYTPYPETVTHAFVDEAARTGVDIFRIFDALNNVDSMRPAIDAVRATGSAV
AEVAMSYTGDLSDPAETLYTLDYWLRLAEQIVEAGAHVLAIKDMAGLLRPPAAATLVSAL
RSRFDLPVHVHTHDTPGGQLATYTAAWHAGASAVDGAAAPLSGTTSQPALSAIVAAAAHT
PFDTGINLDAVCDLEPYWELLRRVYAPFESGLPAPTGRVYHHEIPGGQLSNLRTQAIALG
LGERFEDVENAYAGADRILGRLVKVTPSSKVVGDLALALVGADITAEEFAEDPARHDIPD
SVIGFLRGELGDPPGGWPEPLRTKALEGRGAAKPEQPLSVEDEKILGEPGAARQAALNRL
LFPGPTKEFEAHREEYGDTSGLSANQFFSGLRHGDEHRIELERGVELIVGLEAISDPDER
GMRTVMCIINGQLRPVLVRDNNIAEIVPAAEKADRTNPDHVAAPFAGVVTVGVSVDEKVK
AGQTIATIEAMKMEAAITAPKSGTVTRVAVSSTAQVEGGDLLVVIGSEGLTGGSA
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctaaagtcctcgtcgctaatcgcggtgagatcgcgatccgagcattccgcgcc
gcttacgagatgggcatcggcacggtcgcggtgtttccgttcgaggaccgcaattctttg
catcggttgaaggctgatgagtcgtatcagatcggtgagatcgggcatccggtgcgggcg
tatctgtcggtggatgagatcgtcgccaccgccgaggccgccggggccgatgcgatctat
ccgggctacggattcctgtcggagaaccccgagctggcggcggcgtgtgcggcgtcgggc
atcacgttcatcggtcccgatgcctcgattttggagttgacgggcaacaaggctcgcgcg
atcgccgcggcccgtgatgccggcctgccggtgttggcgtcctcggccccgtcggcgtcg
gtcgaggaactggtcgccgcggcccagtcgatggatttcccgttgttcgtcaaggccgtc
gccggcggcggcggccgcgggatgcgccgggtcaccgagccggccgcgctgcccgaggcc
atcgaggcggccagtcgcgaagcggagtcggcgttcggcgatcccacggtgttcctcgaa
caagctgtggtgaatccgcggcatatcgaggtgcagatcctggccgacacttacggcaac
gtcattcacctgtacgagcgtgactgcagcgtgcaacgccgtcatcagaaggtcatcgag
ctggccccggcgccgaatctggatcccgctctgcgcgaccagatctgcgccgacgccgtg
gcgttcgcccaccacatcggatacagctgcgccggcacggtggagttcctgctcgacgag
cgcggccggcacgtctttatcgagatgaatccccggatccaggtggagcacaccgtgacc
gaggagatcaccgacgtcgacctggtgtcggcgcagctgcgaatcgccgcgggggagacg
ctggcggatctgggcctgagccaggaccggatcgccccgcacggcgcggcgctgcaatgc
cgcatcaccaccgaggacccggcgaatggctttcggcccgacaccggccgcatcacgacc
taccgctcaccgggcggggcggggatccgcctggacggcggaacccacctgggcgccgaa
gtcacggcgcacttcgattcgatgctggtcaagctgacctgccgcggccgtgatttcccc
accgcggtggcccgggccaagcgggcggtggccgaattccgcatccgcggtgtgtcgacg
aatatcccgttcctgcaggcggttctggacgacccggacttccaggccggccggatcacc
acctcgttcatcgacgagcgcccggaattgctgaccgcgcgcacgtcggctgaccgcgga
accaagatgttgaagttcctggccgaggtgactgtgaactcgccgtatcgggaccgaccc
cggtactacccccaggacaagctgcccgatatcgacatcgcggcgagcgcaccgccgggc
agcaaacagcgcctcgacgaactcggcccacagggattcgcccagtggctcaaggattct
ccggcgatcggggtgaccgataccaccttccgcgatgcccaccagtcgctgttggcgacg
cgggtgcggacgtcgggtctgctcaaggtcgctccgtacatcgccaggatgaccccggaa
ctgttgtcgatcgaatgctggggcggcgcgacttacgatgtggcgcttcggtttttgaag
gaagacccgtgggagcgactggccgcgcttcgtgaggcgatccccaacatttgtttgcag
atgctgctacgcggccgaaacaccgtgggttacacgccttatccggagacggtgacgcac
gccttcgtcgacgaggccgcccgcaccggggtggacatcttccggatcttcgacgcgctc
aacaacgtcgattcgatgcgccctgccatcgatgcggtacgtgcaacgggttcggcggtc
gccgaggtcgcgatgtcctacaccggggatctgtccgaccccgccgagacgctgtacacc
ctggactactggctgcggctggccgagcagatcgtcgaggccggtgcgcatgtgctggcg
atcaaggacatggccgggctgttgcgcccgcctgcggcggccaccctggtctctgcgctg
cgcagccgcttcgacctgccggtgcacgtgcacacccatgacaccccgggcggacagctg
gccacctataccgcggcctggcacgccggggccagcgcggtcgatggtgccgcagcgccg
ctgtcgggcaccacaagccagccggctctgtcggcgatcgtcgccgccgcggcgcacacc
cccttcgacaccggtatcaacctggacgcggtctgcgacctggaaccgtactgggagttg
ctgcgccgggtgtacgcgccgttcgagtcgggtctgcccgcgccgaccgggcgggtgtat
caccacgagatccccggtggccagttgagcaacctgcgcacccaggccatcgcgctcggc
ctgggcgagcggttcgaggacgtcgagaacgcctacgccggcgccgaccggatcctgggt
cggctggtcaaggtgaccccgtcgagcaaggtggtcggagatctggcgctggccctggtg
ggcgccgacatcaccgccgaggagttcgccgaggacccagcccggcacgacattcccgac
tcggtgatcgggttcctgcgcggcgagctgggcgatccccccggcggctggccagaaccg
ttgcgcaccaaggcattagagggtcgtggggccgccaagcctgagcagccgctgtcggtc
gaggacgagaagatactcggcgagccgggcgcggctcgccaggccgctttgaaccgattg
ctgttccccggccccaccaaggaattcgaggcgcaccgcgaggagtacggcgacacctcg
ggcttgagcgctaatcagttcttctcgggtctgcgccacggtgacgagcaccgcatcgag
ctcgagcgcggtgtggagctcatcgtcgggctggaggcgatctccgatcccgacgagcgc
ggcatgcgcaccgtcatgtgcatcatcaacgggcagctccgcccggtgttggtgcgcgac
aacaacatcgccgaaatcgtgccggcggccgagaaggctgaccgcaccaaccccgaccac
gtcgccgcccccttcgccggcgtggtcaccgtcggggtcagcgtcgacgagaaggtcaaa
gcgggccagaccatcgccaccatcgaggcgatgaagatggaggctgccatcaccgcaccc
aagtccggcaccgtcacccgcgtcgctgtcagcagcaccgcccaggtcgaaggcggcgac
ctactggtggtgatcggttcggagggcttgaccgggggatcggcctga

DBGET integrated database retrieval system