KEGG   Mycobacterium sp. EPa45: AB431_11095Help
Entry
AB431_11095       CDS       T03960                                 

Definition
(GenBank) theronine dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00030  Pentose phosphate pathway
mye01100  Metabolic pathways
mye01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AB431_11095
Enzymes [BR:mye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     AB431_11095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N FAD_binding_3 ADH_zinc_N Pyr_redox_2 NAD_binding_8 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKK27135
UniProt: A0A0G3IHZ7
Position
complement(2336676..2337734)
Genome map
AA seq 352 aa AA seqDB search
MQALTVQPGKADSLAVEEMQEPTAGPDELRVAGLAIGVCGTDREIAAGEYGWAPSGRDRL
VLGHESLGRVLSAPKGSHFAEGDLVVGVVRRPDPVPCGACAHGEFDMCRNGRYTERGIKE
IDGYGSEFWCVEADYAVKLEDGLADVGMLMEPTTVVAKAWEQVYRIGQRAWFEPRTVLVT
GAGPIGLLAAMLGVQHGLEVHVLDRVTTGPKPGIVDALNATYHHDGVQAAIGKIRPDIVI
EATGVGSLVFDAMTVTGSYGIVALTGVSPKGRTLTVDPGGLSRDIVLENDAVVGSVNANL
RHYQQAAEALGKADPKWLASLITRRIPLSAATQAFTEADDDVKVVITLDDSR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctttgacagtgcagcccggcaaagccgattcgcttgccgtcgaggagatgcag
gaacccactgcaggtcctgacgagttgcgggtcgccggcctggcgatcggggtgtgcgga
accgatagggagatcgctgccggcgaatatggctgggcaccgtccgggcgtgaccggctg
gtgctggggcacgagtcgctgggccgggtgctcagcgcgccgaagggcagtcacttcgcc
gaaggcgatctggtggtcggggtggtgcgccggcctgacccggtgccctgcggcgcgtgc
gctcacggtgagttcgacatgtgccgcaacggtcggtacaccgaacgaggtatcaaggag
atcgacggatacggcagcgaattctggtgtgtggaagccgattatgcggtcaagctcgaa
gatggtcttgccgatgtcggcatgctgatggagccgaccaccgtcgttgcgaaagcctgg
gaacaggtgtaccgcatcgggcaacgagcctggttcgagccgcgcaccgtgctggtcacc
ggcgcaggcccgatcgggctgctggccgcaatgctgggcgtccagcacggcctcgaggtg
catgtgctcgaccgggtcaccaccgggcccaaacccggcatcgtggatgccctgaatgcc
acctatcaccacgacggtgtccaggctgcgatcggaaagattcgcccggacatcgtgatc
gaagcgaccggggtgggttcactggtattcgacgcgatgaccgtcaccggctcctacggc
attgtcgcgttgaccggggtgtccccgaagggccgcaccctcacggtggatccgggcggc
ctcagtcgcgatatcgttctggagaacgacgcggtggtgggttcggtcaacgccaacctg
cgccactatcagcaggccgccgaggcgctgggaaaggctgacccgaagtggttggccagc
ctgataactcgtcgcataccgctcagtgctgccacccaggcgttcaccgaggccgacgac
gacgtgaaggtcgtcatcacactcgacgattcccgttaa

DBGET integrated database retrieval system